KEGG   Cedecea neteri ND14a: LH86_14025Help
Entry
LH86_14025        CDS       T03337                                 

Definition
(GenBank) esterase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
cen  Cedecea neteri ND14a
Pathway
cen00903  Limonene and pinene degradation
cen00930  Caprolactam degradation
cen01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LH86_14025
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    LH86_14025
Enzymes [BR:cen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     LH86_14025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Hydrolase_4 COesterase Peptidase_S9 DUF3089
Motif
Other DBs
NCBI-ProteinID: AIR66169
Position
2930722..2931654
Genome map
AA seq 310 aa AA seqDB search
MLPDNAQAALKGWIKAAGPVVKKVYGQSDADWKEVRADYVRQLDELFPAVEGATFADVSL
GGIGAMLVTPAEVIEGRVMIYIHGGGYVHGGVEAYRGLTGRYARALKAKVYAVDYRQAPE
FPFPTPIDDVFQAYRALLEEGANPRSLMISGDSAGGAMVVTLMRKARDAGLALPAAAVAI
SPWANLTHSGTSAMVRDGLDPLCSVAFLNQLARSFLAGELPTHPDASPVFADVQGLSPTL
IQVGENEVMLSDAIRLASHMSESRVRTTLEVWPEMFHVWHLFAGILPEADQALRNAIRFF
EDALNPANIG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctgataatgcacaggcagcccttaagggctggataaaagccgccgggccggtt
gtgaagaaggtatatggccagtctgatgctgactggaaagaggttcgggctgactatgtg
aggcagttggatgagttgttccctgccgtggagggcgcaacctttgctgatgtcagcctg
ggcggcattggtgcaatgttggtcacgcctgcggaagtcattgagggtcgggtgatgatt
tatattcatggtggaggctacgttcacggtggggtagaagcatatcggggattaaccggg
cgttatgctcgcgccttgaaggctaaagtgtatgcggtagattatcgtcaggcgcctgag
tttcctttcccgacgccaattgatgatgtctttcaggcctaccgagccttgcttgaggag
ggggcaaacccgcgatcgctgatgatttcgggggattctgccggtggggcgatggttgtc
acgctgatgcgtaaagcgcgcgatgctggcctggcattacccgccgccgcagtggctatt
tcaccgtgggctaacttaacgcatagcggcacgtctgcaatggtcagggatgggctggat
cctttatgcagcgtcgctttcctgaaccaactggcgcgaagtttccttgccggagagctg
cctacacatccggatgcctctccggtttttgccgatgtacaaggcctttctcccacgctg
atacaggttggtgaaaacgaagtgatgctgagcgatgctattcgccttgcatcccacatg
agcgaaagccgggttcgcaccacgctagaagtttggccggaaatgtttcacgtctggcat
ttgtttgcggggatcttaccggaggcagaccaggcactgcgaaacgcgataagattcttc
gaagatgcgctaaacccggccaacatcgggtga

DBGET integrated database retrieval system