KEGG   Cedecea neteri ND14a: LH86_15205Help
Entry
LH86_15205        CDS       T03337                                 

Definition
(GenBank) S-(hydroxymethyl)glutathione dehydrogenase
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cen  Cedecea neteri ND14a
Pathway
cen00010  Glycolysis / Gluconeogenesis
cen00071  Fatty acid degradation
cen00350  Tyrosine metabolism
cen00625  Chloroalkane and chloroalkene degradation
cen00626  Naphthalene degradation
cen00680  Methane metabolism
cen01100  Metabolic pathways
cen01110  Biosynthesis of secondary metabolites
cen01120  Microbial metabolism in diverse environments
cen01130  Biosynthesis of antibiotics
cen01200  Carbon metabolism
cen01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LH86_15205
  09102 Energy metabolism
   00680 Methane metabolism
    LH86_15205
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LH86_15205
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LH86_15205
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LH86_15205
   00626 Naphthalene degradation
    LH86_15205
Enzymes [BR:cen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LH86_15205
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     LH86_15205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Met_10 TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AIR66388
Position
3188547..3189665
Genome map
AA seq 372 aa AA seqDB search
MKSRAAVAFGPGKPLEIVEIDVAPPQKGEVLVKITHTGVCHTDAFTLSGDDPEGVFPAVL
GHEGGGIVVEVGEGVTSLKPGDHVIPLYTAECRECKFCKSGKTNLCQAVRATQGKGLMPD
GTTRFSYNGEPIYHYMGTSTFSEYTVVAEISLAKVNPQAPLDKVCLLGCGVTTGIGAVHN
TAKVKEGDTVAVFGLGGIGLAVIQGAVQAKAGRIIAIDTNPEKFTLAREMGATDCINPKD
HEKPIQDVIVELTDGGVDYSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGQEIKTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEDAMAGKINLDPFITHRMPLDKINEAFDLMHEG
KSIRTVIHFGEE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcacgtgctgcggtggcctttgggccgggtaaacctttagaaattgttgaaatc
gacgtcgcacccccgcaaaaaggggaagtgctggtgaaaatcacccacaccggcgtttgc
cataccgatgctttcacgctgtccggcgatgacccggaaggcgtgttcccggcggtactg
ggccacgaaggcggcggcatcgtggtggaagtgggcgagggagtgaccagcctgaagccg
ggcgaccacgttattccgctctacaccgcagaatgtcgcgagtgtaagttctgtaaatcc
ggcaaaaccaacctctgtcaggccgttcgcgctacgcagggtaaaggtctgatgccggat
ggtaccactcgcttctcctacaatggcgagccaatttatcactacatgggcaccagcacc
ttcagcgaatataccgtggtggcggagatctctctggctaaggtcaaccctcaggcaccg
ctggataaagtgtgcctgcttggctgcggtgtaaccaccggcatcggcgcggtgcacaac
acggcaaaagtgaaagagggcgataccgtggcggtatttggcctcggcgggatcggcctg
gcggtgattcagggcgcggtgcaggctaaggccggacgaatcattgccattgataccaac
ccggagaaattcaccctcgcgcgcgaaatgggcgctacagactgcattaacccgaaagat
cacgagaagccgattcaggatgtgatcgttgaactgaccgatggcggcgtggattacagc
ttcgaatgtatcggcaacgtgaacgtgatgcgttccgcgctggaatgctgccacaaaggc
tggggcgaaagcgtgattattggcgtggccggggccggtcaggaaattaaaactcgtcca
ttccagctggtgacaggccgcgtctggcgcggttcggcgttcgggggcgttaaaggccgc
actcagctgccgggtatggtggaagacgcaatggcgggcaaaatcaatcttgatccgttc
attactcaccgcatgccgctggacaagatcaacgaagcgtttgacctgatgcatgaaggc
aaatcgattcgaactgtgatccatttcggcgaagagtaa

DBGET integrated database retrieval system