KEGG   Cedecea neteri ND14a: LH86_17020Help
Entry
LH86_17020        CDS       T03337                                 

Definition
(GenBank) S-adenosylmethionine tRNA ribosyltransferase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
cen  Cedecea neteri ND14a
Brite
KEGG Orthology (KO) [BR:cen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LH86_17020
Enzymes [BR:cen01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     LH86_17020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AIR66722
Position
complement(3584839..3585720)
Genome map
AA seq 293 aa AA seqDB search
MSEPTLATIHDLHSHTTASDGLLSPEALVNRAVDMRVTVLAITDHDTVAGLPAARTEIQR
LNLPLQLISGVEISTVWENHEIHIVGLGIDEQHPALKLFLEQQSERRSQRAEMIAERLDK
ARIPGALEGAMRHAGSGAITRGHFARFLVEQGKASNMADVFKKYLAKGKTGYVPPQWCTI
EQAIDVIHHSGGQAVLAHPGRYGLTAKWLKRLLAHFAEHGGDAMEVAQCQQAPNERTQLA
SYAKQFNLLASQGSDFHLPCAWIELGRKLWLPAGVEPVWQHWEQSHIAKERAV
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagcccaccctggccacgatccacgacctgcacagccacactaccgcctcggac
ggcctgttgtctcctgaagctttggttaatcgcgccgtcgatatgcgcgttacggtactg
gcgattaccgatcatgacaccgtggcgggcctgcctgccgcaaggactgaaattcagcgt
ctgaatttaccgctacagttaattagcggcgttgaaatttccaccgtctgggaaaatcac
gaaattcatatcgttggcctgggcattgatgaacagcatcctgcgctgaagctttttctt
gaacagcaaagtgaacgccgcagccagcgcgcggaaatgattgctgagcgtctggataaa
gcacgtattcccggtgcgttagaaggagcgatgcgtcacgcaggcagcggggccattacc
cgagggcattttgcccgttttctggtcgagcagggcaaagccagcaatatggccgatgtt
tttaaaaagtatctggcgaaggggaaaaccggatacgttccgccccagtggtgtacaata
gaacaagctattgatgtgattcatcattctggcgggcaggcggtgctggcgcatccaggg
cgctacggcctgaccgcaaaatggctaaaacgactgctggcgcactttgccgaacacggt
ggcgatgccatggaagttgcgcagtgccagcaggctcccaacgaacgtacccagcttgcg
agctacgctaagcaatttaatctgctggcgtcgcaggggtctgattttcatctgccctgc
gcgtggattgaactgggtcgtaagctgtggctaccggcgggcgttgagcccgtctggcag
cactgggagcagagccacatcgctaaagagagggcagtatga

DBGET integrated database retrieval system