KEGG   Cedecea neteri: LH86_21385Help
Entry
LH86_21385        CDS       T03337                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cen  Cedecea neteri
Pathway
cen00052  Galactose metabolism
cen00500  Starch and sucrose metabolism
cen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cen00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LH86_21385
   00500 Starch and sucrose metabolism
    LH86_21385
Enzymes [BR:cen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LH86_21385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: AIR67548
Position
4526380..4527822
Genome map
AA seq 480 aa AA seqDB search
MNTPLNKAQSALETLQTTRGNAFYPLYHLAPPAGWMNDPNGLIYHNGLYHAFYQHHPFDE
NWGPMHWGHATSRDMVRWEHQPIALAPGDEWDRDGCFSGSAVDDNGVLSLIYTGHLWLAG
AGNDSAIRQVQCLATSEDGVHFKKQGVILTPPPGIRHFRDPKVWQQDGTWWMVIGARDEQ
DRGKVLLYRGTSLHDWQLDRILAEASADMGYMWECPDFFPLGKSQILMFSPQGIKAKGWA
YQNLFQSGYLRGRWQPGKDFIVYQPFEEMDHGHDFYAPQSFIAEDGRRIVLGWMDMWESP
MLSKREGWAGCLTVPRELCMMPNGKLYQNPVHELATLRAGEQLVLPCVLDTQKQMLHPNA
EAVELEIAWEAWQSTAERYGIRLGQGCELFVDALTQRLVLSRGYQDTQLDGNRSVPLLEN
GDLHLRIFIDRSSIEVFVNHGEYCLSSRLYPQPGERQLELFASHGKALCRGGTLWQLNAL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaataccccactgaacaaggcgcaatccgccttagaaaccctgcaaacaacgcgcggc
aacgccttttatccgctctatcatttggccccgcccgcgggctggatgaacgatcctaac
ggcctgatttaccataacgggctttaccacgccttctatcagcaccatccgttcgatgaa
aactgggggccaatgcattggggccatgccaccagccgggatatggttcgctgggagcat
cagcccattgcgctggcacctggagacgaatgggatcgcgatggctgtttctccggcagt
gcggtggacgataacggtgtgctctcgctgatttacacgggacatctctggctggctgga
gccggaaacgatagcgcgatacgtcaggtgcaatgtctcgccaccagcgaagacggtgtt
cactttaagaaacaaggcgtcattcttaccccaccgcctggcatcaggcatttccgcgat
ccgaaggtatggcaacaggatgggacctggtggatggtcattggtgcccgagacgagcaa
gaccgaggcaaagtattgctttatcgaggcacttcacttcatgactggcagttagatcgt
attctcgcagaagccagcgcggatatgggttatatgtgggaatgcccggacttcttcccg
ctcggaaaaagccagatcctgatgttttctccgcagggcatcaaggcgaaaggctgggca
taccagaacttgttccagagcggctatttacgagggcgatggcaaccagggaaagatttc
atcgtttatcagccgtttgaagagatggatcacggccacgatttttacgccccgcagtcc
tttatcgccgaagatggccgccgcatcgtgctgggctggatggacatgtgggaatctccc
atgctttctaaacgcgaaggctgggcgggttgccttaccgtgccgcgcgagctgtgcatg
atgccaaacggcaaactttaccaaaatccggttcacgaactggccacgctccgcgccggg
gagcaattagtgttgccctgcgtgctggatacgcaaaagcagatgttgcacccgaatgcg
gaagccgtagagttagagatagcctgggaagcctggcaaagcacggctgaacgctacggc
attcgcctgggacagggttgtgagctgtttgtcgatgcattgacgcagcgtctggtgctg
tcacgcggctatcaggatacgcagttggatggcaatcgcagcgtgccgttattggaaaac
ggcgacctgcatctgcggatttttatcgatcgctcttccatcgaagtctttgttaaccat
ggcgaatattgtcttagcagccgcctctacccgcagccaggggaacgtcaactggaactg
tttgccagccacgggaaagccttatgccggggcggcacgctgtggcaattgaacgcacta
tag

DBGET integrated database retrieval system