KEGG   Cyanobacterium endosymbiont of Epithemia turgida: ETSB_0420Help
Entry
ETSB_0420         CDS       T03622                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
ceo  Cyanobacterium endosymbiont of Epithemia turgida
Pathway
ceo00471  D-Glutamine and D-glutamate metabolism
ceo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    ETSB_0420 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ceo01011]
    ETSB_0420 (murI)
Enzymes [BR:ceo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     ETSB_0420 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:ceo01011]
 Precursor biosynthesis
  Racemase
   ETSB_0420 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: BAP17277
UniProt: A0A077JED5
Position
669252..670097
Genome map
AA seq 281 aa AA seqDB search
MNNVQNSPIGVFDSGVGGLTVLRELYQQLPQESIIYFADTARLPYGNRSESEILRFVREI
LVWMNQQNVKMVIMACNTSSALALETVRSEFNFPILGVILPGARAAVQQGQRIGVISTPA
TAKSGAYRQAIQEINPDAQVWQIGCPEFVPLIEQNRIYDPYTKQVALQYVSPLLARNIDT
LIYGCTHYRHLAPIFREILPSTVNLIDPASFVVQAAEKELKLMGLYRNYTAQATRFYVSG
CPKTFPKVSQQWLGYCPVVESVSLPKIMRSSWAREETEILE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgttcaaaacagtcccattggtgtctttgatagtggcgtggggggactaacc
gttttgcgagaactttaccaacagttgccccaggagtcgatcatttattttgcagacaca
gctcgtttgccttatggaaatcgttctgagtcggaaattttgcggtttgttcgagaaatt
ctcgtctggatgaaccaacaaaacgtaaagatggtaattatggcttgtaataccagttca
gccttggcattagagacagtccgcagcgagtttaattttcctattttaggggttatcttg
ccaggggcaagggcagcagttcaacaaggtcaacgcattggggttatttccaccccagca
acggcaaagagtggtgcttatcgtcaagcaattcaagaaattaaccctgatgctcaagtt
tggcaaataggatgtcctgaatttgttcccctaattgaacaaaaccgaatttatgacccc
tatacaaaacaggtcgctctacagtatgtgagtccactactggctcgtaatattgatact
ctaatctacgggtgtacccattatcgtcatcttgctcccatctttcgtgaaattctcccc
tcaactgtcaacctcatcgatcctgccagttttgtggtacaagctgctgaaaaagagttg
aaattaatgggattataccgaaattatactgctcaagctactcgtttttatgtcagtggt
tgtcctaagacttttcctaaggtttcccaacaatggttaggttattgtccagtcgttgag
tcggtttcccttccgaaaataatgagatcttcctgggctcgggaagaaactgaaattctt
gaatag

DBGET integrated database retrieval system