KEGG   Crinalium epipsammum: Cri9333_0116Help
Entry
Cri9333_0116      CDS       T02373                                 

Definition
(GenBank) oxidoreductase domain protein
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
cep  Crinalium epipsammum
Pathway
cep00860  Porphyrin and chlorophyll metabolism
cep01100  Metabolic pathways
cep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cri9333_0116
Enzymes [BR:cep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     Cri9333_0116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GFO_IDH_MocA NAD_binding_3 Shikimate_DH F420_oxidored Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFZ11116
UniProt: K9VT68
Position
147995..148990
Genome map
AA seq 331 aa AA seqDB search
MSNFTILGDNSIPLKVGMVGTGYAAKLRAETLQSDPRSHLMAVAGHTPAKTEEFSQTYQA
RAMRSWEELVELPELDLVIVATINRDHSAIARAALEADKHVIVEYPLALNVTEAEELISL
AKARGKLLHIEHIELLGGLHQALKQSLPTIGEPFYARYSTIAPQHPAPRKWTYHPDLFGF
PFMGALSRLHRFTDLFGTVATVSCQARFWGSESFYTACICTAQLRFNNGLMAEVIYGKGE
NLWQESRTFEVHGEQGGLIFNGDQGTLVQPEGSTPIAVGSRRGLFAKETTMVLDYLTEGK
PLYVTADASVYTLKVADAARRSAETGKTIKV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattttactattttaggggataattctatccctttaaaagtgggaatggtgggt
actggatatgcggctaagttaagagcagaaactttgcaatcagatccgcgatcgcatttg
atggctgttgcaggtcatacaccagctaaaaccgaggaattttctcaaacataccaggcc
agagcaatgagatcctgggaggagttggtggaactgccagaactagatttagtgattgtt
gccacgatcaaccgcgatcatagtgcgatcgcccgtgctgccttagaagctgacaagcac
gtaattgtcgaatatcccctcgccctaaatgtcacagaagcagaagaacttatatcttta
gctaaagctagaggcaaacttttacatatagaacatatagaactactcggtggcttacac
caagcactcaagcaatcattacctaccattggcgaacctttttatgctcgctacagtacc
atcgcgcctcagcatcctgctccccgcaagtggacttaccaccccgatttgtttggtttt
cccttcatgggcgcactttccaggctacaccgatttacagatttgtttggtacagttgcg
actgttagttgtcaagctagattttggggtagtgaatcattttacacagcctgtatctgt
acagcacagttacgcttcaacaatggtttaatggctgaagttatttatggtaaaggcgaa
aacctttggcaggagtcacgaacctttgaagttcatggtgagcaagggggattaattttt
aatggtgatcaaggaactttggtgcagccagaaggaagtacaccaatagcagtcggtagc
cgccgaggattatttgctaaggaaaccacaatggtattagattacttaaccgaagggaaa
cctctgtatgtaacagcagatgctagcgtgtataccctgaaagttgctgatgctgcacgt
cgctctgcggaaacaggtaaaacgatcaaagtttaa

DBGET integrated database retrieval system