KEGG   Crinalium epipsammum: Cri9333_2040Help
Entry
Cri9333_2040      CDS       T02373                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cep  Crinalium epipsammum
Pathway
cep00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cep00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Cri9333_2040
Enzymes [BR:cep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Cri9333_2040
Transporters [BR:cep02000]
 Other Transporters
  Pores ion channels [TC:1]
   Cri9333_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AFZ12919
UniProt: K9VZE9
Position
complement(2319343..2319900)
Genome map
AA seq 185 aa AA seqDB search
MLKLYGGARSRASIVQWYLEELSVPYEFVLLDMQAGEHQKPEYLAINPTGKVPAIVDGDF
KLWESGAILLYVAQKYGNISPSLEQQAELIQWVLFANATLGPGIFVEATREKETPKLLTP
LNQIFEKQPFLLGEDFTVGDVAVGSMLAYIPMMLKLDLSAYPAVVEYIKRITQRPAFQKV
MSARS
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagctctatggtggcgctcgtagtcgagcatcaattgtccagtggtatctagaa
gaattgagtgttccctatgaatttgtcctgctagatatgcaggctggagaacaccaaaaa
ccagaatacctggcgattaacccaacaggaaaagtacccgcaattgttgatggagatttc
aaactttgggaatcaggggcaatattgttatatgtagctcaaaaatatggcaatatttcc
ccatctttagagcaacaagctgaacttattcaatgggtgctgtttgctaatgctactttg
ggaccaggaatttttgtagaagcaactcgtgaaaaagagacaccaaaattactgacacca
ttaaatcaaatctttgaaaagcaaccattcttgctgggtgaagattttactgttggtgat
gttgccgttgggtcaatgttagcttatatcccaatgatgctaaagcttgatttaagtgcc
tatcctgctgtagtggaatatattaagcgcattacacagcgaccagcattccaaaaagtg
atgtcagcacgcagttaa

DBGET integrated database retrieval system