KEGG   Crinalium epipsammum: Cri9333_3259Help
Entry
Cri9333_3259      CDS       T02373                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cep  Crinalium epipsammum
Brite
KEGG Orthology (KO) [BR:cep00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cri9333_3259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HTH_IclR
Motif
Other DBs
NCBI-ProteinID: AFZ14090
UniProt: K9W3U3
Position
complement(3659931..3661046)
Genome map
AA seq 371 aa AA seqDB search
MLIFALLLATLFLAYSNGANDNFKGVATLFGSQTTSYKVAIWLATLATFAGSLASIFLAE
TLLKNFSGKGLVPDAIADSTEFHLAVALGAGLTVIIATLTGFPISTTHGLTGALVGAGLV
AIGTQVNFEKLGSSFFLPLLISPLVAIALGAVLYGLLRFLRVRLGIQKEWCICAGETQQF
IPIPQPDATNILQCIKTTDVAVDSTEKCTQRYIGKFGKITNQQLVDAFHFLSAGIVSFAR
GLNDTPKIVSIILIVKALSIQGAMLAVGIAIALGGILNARKVAETMSKKITAMNHGQGLI
ANVVTGSLVIAASGYGLPVSTTHVSVGSIFGVGLISQKANAKVFYQILLSWLLTLPIAAT
ISAIVYWLLSR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgttaatttttgccttgcttttagctaccctatttttagcttactctaacggtgctaat
gataactttaaaggcgtagctactttatttggtagccaaacaactagctataaagttgcg
atttggttagctacattagcaacgtttgctggctcattagcatctatttttttagcagaa
acgctgttaaaaaacttttcgggtaaggggttggttccagatgcgatcgccgattctaca
gaatttcacctagcggttgctcttggtgctggtttaacagtgataattgccacactcact
ggttttcccatctctacaactcacggcttaacaggggcgctagtcggggcaggtttagta
gcaattggcacacaagttaattttgagaaactgggaagctcattttttctcccattgtta
attagccccttagtagcgattgcattaggtgcagttttgtatggcttattgcgttttctg
cgagtgcgtttaggcatacagaaagaatggtgtatttgtgcgggagaaacacaacaattt
attcccattccccaaccagatgctactaatattttacagtgcatcaaaacgacagatgta
gcagtagattcaacggaaaaatgtacccaaaggtatataggaaaatttggcaaaatcacg
aatcagcaattagttgatgcttttcactttcttagtgctggaatagttagctttgctaga
gggttaaatgatacacccaagattgtctcaattatcctgatagttaaagctttatcaatt
cagggagcaatgttagccgtaggaattgcgatcgcacttggcgggatcttaaatgcgcgt
aaagttgccgaaaccatgagtaaaaaaattactgccatgaatcatggtcaaggattaatt
gctaatgtggtgacaggatcgttagtaattgctgctagtggatacggtttacccgtttct
accacccatgtttcagttggttctatttttggcgttggcttgatttcccaaaaagctaat
gccaaggttttttatcaaattctcttgtcatggcttttaaccttacctattgcagctacg
atcagtgcgatcgtttactggttattgagcaggtaa

DBGET integrated database retrieval system