KEGG   Cyanobacterium endosymbiont of Rhopalodia gibberula: RGRSB_0164Help
Entry
RGRSB_0164        CDS       T05747                                 

Definition
(GenBank) glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cer  Cyanobacterium endosymbiont of Rhopalodia gibberula
Pathway
cer00511  Other glycan degradation
cer00600  Sphingolipid metabolism
cer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    RGRSB_0164
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    RGRSB_0164
Enzymes [BR:cer01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     RGRSB_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N
Motif
Other DBs
NCBI-ProteinID: BBA78783
UniProt: A0A2Z5T7X9
Position
complement(260987..263395)
Genome map
AA seq 802 aa AA seqDB search
MKTPFSFPTIPLCTWKRPIGKGWDNPYTARRASNLDDGPNHGMPLGGFGAGCIGRSPHGD
FNLWHFDGGEHTFGSIPACQFSVFEQSEGENSQAYALCTQPPENGTLSTWNWYPTEKGTY
HALYPRSWYEYQGVFQSKLVCEQFSPIIPNNYQETSYPLAIFEWTAHNPTNKPITLSIMV
TWQNIVGWFTNAIKSPEITVRDDGSPEYKYQPRWGQSTGNFNQWVRDNFGVGFILNHIQL
QTQVQEGEGQICIASMTNPSIEVFYLGKWNPKGDGSEVWDNFAINGSLPNTEDETPAEPG
EQLAAAMTIRFTIRPGKTKKIPFVLAWDFPVTEFAQGVEYYRRYTDFFNRNGKNGWAIVK
TALKNFGVWHKRIEEWQSSIIERDDLPDWFKMALLNELYLLTDGGTLWTAASENDPIGQF
GVLECLDYRWYESLDVRLYGSFGLMMLWPRIEKSVLEAFARAISTYDETIRTIGYNQVKA
IRKAKGATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLGSDFVLQVYRDYLLTPGKDKEFL
GKCWPAIAETLTYLKTFDLDNDGIPENSGAPDQTFDDWQLQGISAYCGGLWIAALEAAIK
IGEIILNNPPINLEFELKLVSDHIKSYNHWLKQSRLIYHKTLWNGEYYQLDSKSGSNVVM
ADQLCGQFYARLLGLPDIVEEQYIQSTLNKIYDACFLKFQEGKYGAANGMKPDGIPEDPN
STHPQEVWIGINFGLAAFLVQMGRRDEALKLTEVVIKQIYENGLQFRTPEAITAVGTFRV
CHYLRAMAIWGIYGVLTNFSSL
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaccattttcttttcccacgattcctctttgcacttggaaacgtcccatcggt
aaaggatgggataatccctatacggcacgaagagctagtaatttagacgatggaccaaat
catgggatgcctctcggtgggttcggagctggttgcattggacgttctccccacggtgac
ttcaacctttggcattttgatgggggtgaacatacattcggcagtattcctgcctgtcag
tttagcgtctttgaacaatctgaaggggaaaattctcaagcttatgctctgtgtacccaa
ccgcctgaaaatggaactttatcaacttggaattggtatcctacggaaaaaggaacttat
cacgctctttatcctcgcagttggtatgaataccaaggtgtatttcaaagtaaactagtc
tgtgagcaattttccccaattattccaaataattatcaggaaacaagctatcccttagct
atctttgaatggactgcccacaatcccacgaataagcctattactctcagtattatggta
acgtggcaaaatattgtgggatggtttaccaatgccattaaatctcctgaaattaccgtt
agagacgatggtagccctgaatataaatatcaaccccgatggggacagagtacgggaaat
tttaatcaatgggtgcgagataactttggtgttgggtttattctcaaccacattcaactc
cagactcaagtacaagaaggggaaggacaaatttgcattgctagtatgactaatcccagt
atcgaagttttttatctgggaaaatggaatcccaaaggagatggttcagaagtttgggat
aatttcgctataaatggatcgttaccaaataccgaagatgaaactccagccgaacctgga
gaacaacttgctgcagccatgaccattcggtttactattcgtcctgggaagactaagaaa
attcccttcgttttagcctgggattttcctgtcacagaatttgctcaaggagtagaatat
tatcgtcgctacactgacttttttaatcgtaatggtaagaacggttgggcaatagttaaa
acagctttaaaaaattttggtgtttggcataaaaggatagaagaatggcagtcttctatc
attgaaagagacgatttacctgactggtttaaaatggctttattgaatgaattgtattta
ctcactgatggaggaactttatggacagccgcctcagaaaatgatcctattggacaattt
ggcgtgctcgaatgtctagactatcgttggtatgaaagtctagatgttcgactatatggt
tcctttgggttaatgatgctttggccaagaatagaaaagtcagttttagaagcatttgct
agagcaatttcaacctatgatgaaaccattagaactattggatataaccaagtaaaagca
attagaaaagccaaaggggcaacccctcatgacttaggcgcccccaatgaacatccctgg
gaaaaaactaattatactagctatcaagattgtaatttatggaaagatttaggcagtgat
tttgttctgcaagtgtatcgagattacttattaacaccaggtaaagataaagagttttta
ggaaaatgttggccggcgattgcagaaactttaacttatttgaaaacctttgatttagat
aatgatggtatacccgaaaattccggtgcacctgatcaaacttttgatgattggcaatta
caaggaataagtgcctattgtggcggattatggatagcagccctggaagcagctattaaa
atcggcgaaattatcctaaacaatcctccaatcaatttagaattcgaactaaaactagtc
agtgatcatataaaaagttacaatcactggttaaaacaatctcggttgatttatcacaag
actttatggaatggagaatactatcaactcgatagtaaaagtggttctaatgtggtgatg
gcagatcaattgtgtggtcaattttatgcccgtttattagggttgcctgatatagttgaa
gagcaatatatccagtcaaccttaaacaaaatttatgatgcttgttttttgaagtttcaa
gaagggaaatatggggcagcaaatggtatgaagcctgatggaattcccgaagatcctaat
tcgacccatcctcaagaagtttggataggaattaactttggtttggcggcatttctcgta
caaatgggacgcagagacgaggcgttgaagttaactgaagtagtgattaaacaaatatat
gaaaatggcttacaatttcgtactcctgaagcgataacggctgttggaacttttcgtgta
tgtcattatctacgggcaatggctatttggggaatttatggagtattaactaattttagt
tctttataa

DBGET integrated database retrieval system