KEGG   Cyanobacterium endosymbiont of Rhopalodia gibberula: RGRSB_0562Help
Entry
RGRSB_0562        CDS       T05747                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
cer  Cyanobacterium endosymbiont of Rhopalodia gibberula
Pathway
cer00561  Glycerolipid metabolism
cer00640  Propanoate metabolism
cer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    RGRSB_0562 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    RGRSB_0562 (gldA)
Enzymes [BR:cer01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     RGRSB_0562 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BBA79130
UniProt: A0A2Z5TG78
Position
complement(881425..882579)
Genome map
AA seq 384 aa AA seqDB search
MPSKTSPVSPCVSTTLTPLLVSPSQVIKGEGVLFQARNVIADFGQRPLVVGGQQTLKVIS
PHFDPIFSKCRLKSAYAIYTPDCSESSLDALKTTLKEHQGDVIIGVGGGKALDIAKLLAH
QRQLPIITVPTSAATCAAWTALSNLYSNEGAFQHDVSLSRCPDLLILDYAIIKTASERTL
VAGIGDAIAKWYEASVSSGDSTTTLTIAAVQQARVLRDLLFQKSVAALKTPGGEVWREVV
DACVLLAGVIGGLGGANCRTVAAHAVHNGLTHIRAAHSILHGEKVAYGILVQLRLEEMIQ
SNQLAVSSRQQLLKFYEEIGLPKTLEELGLSNVTLGELRRAADVTCCPESDIHRLPFVVS
SEQLLAAMVSTTSDFVSDRIFSNV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgccctcaaaaacttctcctgtctctccttgtgtgtctacaaccttaacccctttgtta
gtctcccctagtcaagtgatcaagggagagggggtcctgtttcaagctcgaaacgtgatc
gccgattttggccaacgtcctttagtcgtgggaggacagcaaactcttaaggttatttcc
ccccactttgatcctatctttagtaagtgtaggttaaagtcagcctatgccatctatacg
ccggactgttcagagagctctttagacgctcttaaaacgacacttaaggagcatcaagga
gatgttattatcggggtggggggaggtaaagctcttgatattgcaaaattactcgcccat
caacgtcagttgcctattatcactgtcccaacttcagcagctacctgtgcagcgtggaca
gctttgtcaaatctttattctaatgaaggggcatttcaacacgatgtttctttatcaaga
tgccccgatttactgattttagactacgctattatcaaaacggcctcagaacggacttta
gtggcagggataggcgatgcgattgctaaatggtatgaagcttctgtcagtagtggtgat
tctactactacccttaccattgctgctgttcaacaagcacgagtattacgggatctattg
tttcagaagtcagtagctgccctgaaaactcctggaggtgaggtgtggcgagaagtagtt
gatgcttgtgtgttattagctggagttattggaggattaggtggagctaattgccgtact
gtagctgcccatgcagtacacaatggattaacccatattagggcagcccacagtatttta
cacggggaaaaagttgcctatggcattctagttcaactgcgcctagaggaaatgatccaa
agcaatcagttggcggtttcctctcgacagcaattactaaaattttacgaggaaattggt
ttaccaaaaaccttagaagagttagggttatctaacgtgacattaggtgaattgcgccga
gcagcagatgtcacttgttgtcctgaatcagatattcaccgccttccttttgttgtttca
tctgaacagttattagcagcaatggtatctactactagtgattttgtttctgacagaatt
ttctcaaatgtctag

DBGET integrated database retrieval system