KEGG   Chlamydia trachomatis E/SW3: ESW3_1721Help
Entry
ESW3_1721         CDS       T02164                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
ces00260  Glycine, serine and threonine metabolism
ces00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ces01100  Metabolic pathways
ces01110  Biosynthesis of secondary metabolites
ces01130  Biosynthesis of antibiotics
ces01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ces00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ESW3_1721 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ESW3_1721 (trpA)
Enzymes [BR:ces01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ESW3_1721 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA
Motif
Other DBs
NCBI-ProteinID: CCE12445
Position
194848..195609
Genome map
AA seq 253 aa AA seqDB search
MSKLTQVFKQTKPCIGYLTAGDGGTSYTIEAAKALIQGGVDILELGFPFSDPVADNPEIQ
VSHDRALAENLTSETLLEIVEGIRAFNQEVPLILYSYYNPLLQRDLDYLRRLKDAGINGV
CVIDLPAPLSHGEKSPFFEDLLAVGLDPILLISAGTTPERMSLIQEYARGFLYYIPYQAT
RDSEVGIKEEFRKVREHFDLPIVDRRDICDKKEAAHVLNYSDGFIVKTAFVHQTTMDSSV
ETLTALAQTVIPG
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattaacccaagtttttaaacaaactaagccatgtattggctatctaaccgct
ggtgatggcggtactagttatactattgaggcggcaaaagctctgattcaaggaggtgtc
gatattctggaactaggatttcctttttctgatcctgttgcagataatccagaaattcaa
gtatctcatgatcgggctttagcagaaaatctgacgtcagaaactttgttagagatcgta
gaaggtatccgagcttttaatcaagaagtcccattgatcttatatagctactacaatccg
cttctacaaagggacttagattatctacgcagactaaaagacgcgggaataaatggtgtg
tgcgttatagatcttccagcacctttatcacacggagaaaaatctccattttttgaagat
cttttagctgtaggattggatcctattttgcttatttctgcagggacaacgccggagcgg
atgtctttaatacaagaatacgcaagaggctttctgtattatatcccatatcaagctacg
agagattctgaagtaggtatcaaagaagaatttcgaaaagtcagagaacattttgatctt
ccaattgtagatagaagagatatttgtgataaaaaagaagctgcacatgtgctgaattat
tcagatggtttcattgtgaaaacagcgtttgttcatcagacaacaatggattcttcggta
gagactctgactgcacttgcacaaacagttattcctggataa

DBGET integrated database retrieval system