KEGG   Chlamydia trachomatis E/SW3: ESW3_1861Help
Entry
ESW3_1861         CDS       T02164                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
ces00030  Pentose phosphate pathway
ces00480  Glutathione metabolism
ces01100  Metabolic pathways
ces01110  Biosynthesis of secondary metabolites
ces01120  Microbial metabolism in diverse environments
ces01130  Biosynthesis of antibiotics
ces01200  Carbon metabolism
Module
ces_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ces_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:ces00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ESW3_1861 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ESW3_1861 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ces04147]
    ESW3_1861 (zwf)
Enzymes [BR:ces01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ESW3_1861 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ESW3_1861 (zwf)
Exosome [BR:ces04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ESW3_1861 (zwf)
  Exosomal proteins of colorectal cancer cells
   ESW3_1861 (zwf)
  Exosomal proteins of bladder cancer cells
   ESW3_1861 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N VWA_3
Motif
Other DBs
NCBI-ProteinID: CCE12459
Position
207671..209194
Genome map
AA seq 507 aa AA seqDB search
MEEIKDFGPTLPACPPCIVVIFGATGDLTSRKLFPALYNLTKEGRLCENFVCVGFARRPK
SHEQFREEMKLAVQHFSHSSEIDIRVWESLENRIFYHQANFSDAEGYSALKAYLEQLDQQ
YGTQGNRLFYLSTPPDYFQEIIRNLNRHQLFYHEQGAQQPWSRLIIEKPFGVNLETAREL
QQCIDANIDEESVYRIDHYLGKETVQNILTIRFANTLFESCWNSQYIDHVQISVSESIGI
GSRGNFFEKSGMLRDMVQNHLTQLLCLLTMEPPSEFSSEEIKKEKIKILKKILPIREEDA
VRGQYGEGIVQDVSVLGYREEENVDPNSSVETYVALKLFIDNPRWKGVPFYLQAGKRLPK
RTTDIAVIFKKSSYNLFNAENCPLCPLENDLLIIRIQPDEGVALQFNCKVPGTNKLVRPV
KMDFRYDSYFNTVTPEAYERLLCDCILGDRTLFTSNEEVLASWELFSPLLEKWSQVRPIF
PNYMAGSLRPQEADELLSRDGKAWRPY
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttggaagaaattaaagactttggccccacattaccagcctgtcctccctgtatcgtggtc
atttttggtgctacaggagacttgacctctaggaagctctttcctgctttatacaattta
acaaaggaaggacgtctatgcgaaaactttgtttgtgttgggtttgctaggcgacctaag
tctcatgagcaatttcgcgaagaaatgaagcttgccgttcagcatttctctcactcatcg
gaaatagatattcgagtttgggaaagtctggaaaatagaatcttttaccaccaagctaat
ttttctgatgccgaaggctactctgctctgaaagcttatttggagcaactagatcaacaa
tatggaacacaagggaatcgtcttttttatttatcaacaccaccagattatttccaggaa
atcatccgcaatttaaatcggcatcagctattctatcatgaacaaggagcacaacagcct
tggtctcggctaattatagaaaagccttttggagttaatttagaaacagctcgagagctt
caacaatgcattgatgccaatattgatgaagagtcggtttatcgaatagaccattattta
ggaaaagaaacggttcaaaacattctgactattcgttttgctaatactctctttgagtct
tgctggaattctcagtacatagatcatgtgcaaatcagcgttagcgaatcaattggtata
ggatctcgagggaatttcttcgaaaagtcgggcatgctacgagacatggtacagaatcat
ttgacgcagctgctatgtctactgactatggaacctccttctgaattttcttccgaagaa
ataaaaaaagaaaaaattaaaattctaaagaaaattcttcctatccgcgaagaagatgct
gttcgtggccaatatggtgaagggattgtgcaagatgtttcagttctgggctatcgggag
gaagaaaatgtcgatccgaattcttcagtagaaacctacgttgcgttaaaattatttatc
gacaatcctcgctggaaaggggttcccttttacttacaagcagggaaacgtcttcctaaa
agaacaacagatatcgctgtgatctttaaaaaatccagctacaatttattcaatgcagag
aattgtcctttgtgtccgttggaaaatgatttacttattattcgtattcaaccggatgaa
ggtgttgcgctacaatttaactgcaaggttccaggaacaaataaactcgtacgtcctgta
aaaatggacttccgttacgacagctattttaatactgttactcccgaagcttatgaacgg
ttactgtgcgactgtatccttggggacagaacgctattcactagcaatgaagaagtctta
gcatcttgggaactattttctcctctattagaaaaatggtctcaagtacgccctatattc
cctaactatatggctggatctttacgtcctcaagaagctgatgaactattatctagagat
ggaaaagcttggcggccctattaa

DBGET integrated database retrieval system