KEGG   Chlamydia trachomatis E/SW3: ESW3_3831Help
Entry
ESW3_3831         CDS       T02164                                 

Gene name
pgi
Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
ces00010  Glycolysis / Gluconeogenesis
ces00030  Pentose phosphate pathway
ces00500  Starch and sucrose metabolism
ces00520  Amino sugar and nucleotide sugar metabolism
ces01100  Metabolic pathways
ces01110  Biosynthesis of secondary metabolites
ces01120  Microbial metabolism in diverse environments
ces01130  Biosynthesis of antibiotics
ces01200  Carbon metabolism
Module
ces_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:ces00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ESW3_3831 (pgi)
   00030 Pentose phosphate pathway
    ESW3_3831 (pgi)
   00500 Starch and sucrose metabolism
    ESW3_3831 (pgi)
   00520 Amino sugar and nucleotide sugar metabolism
    ESW3_3831 (pgi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ces04147]
    ESW3_3831 (pgi)
Enzymes [BR:ces01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     ESW3_3831 (pgi)
Exosome [BR:ces04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ESW3_3831 (pgi)
  Exosomal proteins of other body fluids (saliva and urine)
   ESW3_3831 (pgi)
  Exosomal proteins of colorectal cancer cells
   ESW3_3831 (pgi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI hnRNP_Q_AcD
Motif
Other DBs
NCBI-ProteinID: CCE12656
Structure
PDB: 

Position
complement(431774..433351)
Genome map
AA seq 525 aa AA seqDB search
MMGKGFLDCESLVALQEMALHLIDLTASGCLSEERIQKNSLSAEGFTYSYATERVDDRCL
EALQGLTEERELIKQMECMQQGAIMNRIEGFQSESRPVLHTATRAWVRDQDLHEEAAAIA
RHSKEEALRLAEFLYIARAKFSTLVQIGIGGSELGPKAMYFAMQGSCPSDKRIFFVSNID
PDNAAEVLREIDLEQTLVVVVSKSGTTLEPAANEELFRQAYQNKGLSIAEHFVAVTSQGS
PMDDKSRYLEVFHLWDSIGGRFSATSTVGGVVLGFAFGYEAFIEFLQGAAAIDAHALTPK
MRENLPLLSAMLGVWNRNLLGYPTTAVIPYSTRLKYFTAHLQQCGMESNGKSISREGKEI
SFRTSPIIWGDVGTNCQHSFFQSLHQGTDIVPVEFIGFLHNQRGLDCVLSGSSSSQKLFA
NLVAQSLALAQGRDNANPNKRFKGNRPSSILVAQQLSPRIAGSLLAFYEHKFAFQGFCWG
INSFDQEGVSLGKELATQIIGIMSGNAPVEFPEARGMLRLFNVLT
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtaaaggttttttagattgtgagtcattagttgctttgcaagagatggctttg
catctgattgatttgactgcatcaggatgcttatctgaagagcgtattcagaaaaactct
ttatctgcagaaggatttacctatagttatgctacggaacgtgtagatgatcgctgctta
gaggctttacaaggacttactgaagagagggaattgatcaaacagatggagtgtatgcaa
caaggcgccatcatgaatcgtatagaaggttttcagagcgaatctcgccctgtattgcat
acggcaacacgcgcttgggttcgagatcaagatcttcatgaagaagctgctgcgatagca
agacactctaaggaggaagctcttcgtcttgcagagtttctgtatatagctcgtgctaaa
ttttctacgcttgtacagataggtattgggggctcggagttgggccctaaagctatgtat
tttgctatgcaaggctcttgcccatctgataagagaatcttttttgtctccaatattgat
ccggataatgctgcagaagtattacgggagatagatttggagcaaacactggttgttgtg
gtttctaagtcaggaacaactttagagcctgcagcaaatgaagagctgttcagacaggct
tatcaaaataaaggtttatctattgcagagcattttgtagcggtaacttctcaaggcagc
cctatggatgataagagtcgttatctagaagtattccatctttgggatagtattggcgga
agattttcagctacatccacggtaggaggagttgtattaggttttgctttcggttacgaa
gcttttatagagtttttgcaaggagcagctgctatcgatgctcatgcgctgactccaaaa
atgagagagaatcttcctcttctatctgcgatgcttggagtttggaatcgtaatctgtta
gggtatcctacaacagcagtgattccttattcgacaagattgaaatattttacagcgcat
ttacaacagtgtggaatggaatccaatggaaaaagtatttcgagagaagggaaggagatt
agttttaggacttcacccattatttggggcgatgtggggacaaactgtcagcattctttt
ttccaaagtcttcatcaaggaacagatattgttcccgtagagttcattggatttttgcat
aaccaacgagggctagattgtgtattatcaggaagctcatcatctcaaaagctctttgca
aaccttgttgctcaatctttagctttagctcagggtagagataatgcgaacccgaataag
aggtttaaagggaacagaccttcttcgatattggtagcgcaacagctttctcctcgtatt
gctggtagtttattggctttttatgagcataaatttgcatttcaagggttttgctgggga
atcaattcttttgatcaagaaggggtttcattagggaaagaattggcaacgcaaattata
ggcatcatgtcggggaatgctcctgtagagtttcccgaagctcgaggtatgttaagactt
tttaacgttttaacataa

DBGET integrated database retrieval system