KEGG   Chlamydia trachomatis E/SW3: ESW3_4171Help
Entry
ESW3_4171         CDS       T02164                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
ces00540  Lipopolysaccharide biosynthesis
ces01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ces00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    ESW3_4171 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ces01003]
    ESW3_4171 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:ces01005]
    ESW3_4171 (lpxB)
Enzymes [BR:ces01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     ESW3_4171 (lpxB)
Glycosyltransferases [BR:ces01003]
 Polysaccharide
  Bacterial polysaccharide
   ESW3_4171 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:ces01005]
 Lipid A
  ESW3_4171 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB LAB_N
Motif
Other DBs
NCBI-ProteinID: CCE12690
Position
470518..472341
Genome map
AA seq 607 aa AA seqDB search
MFPQKITLWLYPLGLFANLFFGTAFCVQWFLTRKKGYSVVPKIFWYLSGTGAVFMICHGF
IQSQYPIALLHSFNLIIYFRNLNIASLNPLPVSKIASLLVSVATAITVSFAIGTRYLPHM
TWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWFYLEYKNQSALPAPFWKASLL
GGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRKPFSNSCFISAGEHSGDTL
GGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFTMEKFQVSGFWEVLLALPKLWYRYQL
LYRNILKTNPRTVICIDFPDFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVLEKY
LDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPNLNWKDQLHLPTDKPFIAAFPG
SRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQF
RYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFLAKYIFNIILPAYSLPNII
LGRTIFPEFIGGKKDFQYEDVAAALNILKTSQAQEKQKDSCRDVYQAINESASSMKECLS
LIFETAS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtttccccaaaaaattacactctggttataccctctaggactattcgccaacctcttc
tttggcacagctttttgtgttcaatggtttttaactagaaagaaagggtattctgtcgtt
cccaagattttttggtatctgtccggtaccggcgccgttttcatgatttgccacggattt
attcaaagtcagtatcctattgctttgttgcattcgtttaatctgattatttatttccgg
aacctgaatatcgcctctctaaatccccttcctgtttcgaaaatagcttctctactagtc
tcagtagcaacagcgatcacggtatcttttgctattggaacgcgttacctccctcatatg
acgtggatggcatccccaaatatcctccatttgaatctaccagaagcgagtttgtcatgg
cagctgataggatgtatcggattgacgatcttctcattgagatttttcatccagtggttc
tatctcgaatacaaaaaccaatccgccctgcccgctcctttttggaaagcaagcctacta
ggaggatctatctgccttctctatttcctaagaacgggggatctcgtaaacgtgttatgt
tatggatgcgggttattcccttctttagcaaatctacgtatcgcttcacgagaagccttc
cgcaaaccttttagcaatagctgctttatttctgcgggcgaacatagtggagatactttg
ggagggaatttattaaaagaaatgcacgcaaaataccctgatattcattgctttggcgtg
gggggaccgcaaatgcgtgcacagaattttcatgcacttttcactatggagaaatttcag
gttagcggattctgggaagtacttttagcactacctaaattatggtaccgctatcagctt
ctctatagaaatattctgaaaacaaatccgcgcacagtgatttgcattgatttccctgat
tttcatttcttattaataaaaaaattacgctctcgaggatataaaggaaagattgttcac
tatgtatgccctagcatatgggcttggagaccttcacggaaaacagttttggaaaaatat
ttagacctgcttttactaatacttccttttgaacaaaacttattcaaagattcagctctg
cgtacagtctatttagggcatcctctttctgaaacaattaaaagcttttctcccaatcta
aattggaaagatcagctccatcttcctaccgataaacctttcattgcagcgtttcctggt
agccgtcgcagcgatatcctgcgtaatctaaccattcaagtgcaggcctttcaagcatcc
tctcttgcatccacacaccatttacttgtatcgtctgcaaatccggaatatgaccatctt
atcctcgaagtgcttcaacagaatcggtgtttgcacagtcatattgttccttcccagttt
cgttatgaattaatgagagaatgtgattttgccctcgccaaatgtggaactatcgtccta
gaaacggctctcaatctaactcctacgatcgtcacttgccagctccgacctttggatact
tttttagctaagtatatctttaatattatccttccagcctactcgctccctaatatcatt
ctaggcagaacgatttttcctgaattcataggtgggaaaaaagattttcaatatgaagat
gttgctgctgctctaaacattctgaaaacatctcaagctcaagaaaaacaaaaagactct
tgcagagatgtgtatcaagcaatcaatgaatctgcatcctctatgaaagagtgtctttct
ctcatattcgaaacagcttcctaa

DBGET integrated database retrieval system