KEGG   Chlamydia trachomatis E/SW3: ESW3_7111Help
Entry
ESW3_7111         CDS       T02164                                 

Gene name
psdD
Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ces  Chlamydia trachomatis E/SW3
Pathway
ces00564  Glycerophospholipid metabolism
ces01100  Metabolic pathways
ces01110  Biosynthesis of secondary metabolites
Module
ces_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ces00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ESW3_7111 (psdD)
Enzymes [BR:ces01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     ESW3_7111 (psdD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: CCE12984
Position
803083..803988
Genome map
AA seq 301 aa AA seqDB search
MAAREMLYVNRETGKVEQERIICSSLVKFFIETRIGRALYSVLCKNSLFSRIVGWCQRLR
VTRYFIKPFVTKYRICIEESASPLHDYASFNDFFVRKLKLDARPICQGEDICVTPADGAY
LVFPSMADLSLFTIKNKPFSLESFLGDPQLAHQYAQGSMAIARLAPFDYHRFHFPIAGIA
EAPRRINGHLFSIHPLMLKRNFEVFTENKREITIITSKEFGEVAYVEVGALNVGSIHQTF
SPGSYVKKGAEKGFFAFGGSTVVLLFQPQRIIFDADLVGYSAQGLETRCRMGQSLGKRFS
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgcgggaaatgttatatgttaatcgcgaaacagggaaggtggaacaggaacgt
atcatctgttcttctctggtaaagttttttattgaaacgagaatagggagagctctgtac
tctgttttatgtaagaatagcctgttttcccgtatcgtaggctggtgtcaaagactgcga
gtgacgcgatattttattaaacctttcgttacaaaatatcgtatttgcatagaagagagt
gcttctcctctgcacgactacgcgtcatttaatgatttttttgtacgaaaactcaaacta
gatgctcgacctatctgccagggagaggatatctgtgtgactcctgctgatggtgcctat
cttgttttcccttccatggcagatctatccttgtttaccattaaaaataagccgttttct
ttagaaagttttttaggggatccgcaattggctcaccaatatgcgcaagggagtatggca
atcgctcgattagctccttttgattaccatcgcttccactttcctatagcgggtattgct
gaggcaccgcgccgtatcaacggccatcttttttctattcatcctcttatgcttaagcgg
aatttcgaagtgtttacggagaataaacgcgaaattaccataattacgtcaaaagagttt
ggtgaggttgcctacgtggaagtaggggcgttaaatgtgggttctatccaccaaacgttt
tctcccggtagttatgtgaaaaaaggtgccgaaaaaggtttttttgcttttggaggatcg
actgttgttctattatttcagccccaacggattatctttgatgcagatctagttggttat
tctgctcagggtttagaaacccggtgtcgaatgggacaatcgttaggaaaacgtttctct
tcataa

DBGET integrated database retrieval system