KEGG   Cellulosimicrobium sp. TH-20: B8281_16625Help
Entry
B8281_16625       CDS       T04804                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
cet  Cellulosimicrobium sp. TH-20
Pathway
cet00620  Pyruvate metabolism
cet00630  Glyoxylate and dicarboxylate metabolism
cet01100  Metabolic pathways
cet01110  Biosynthesis of secondary metabolites
cet01120  Microbial metabolism in diverse environments
cet01200  Carbon metabolism
Module
cet_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:cet00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B8281_16625
   00630 Glyoxylate and dicarboxylate metabolism
    B8281_16625
Enzymes [BR:cet01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     B8281_16625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ARK06103
UniProt: A0A1W6DT41
Position
3720848..3722563
Genome map
AA seq 571 aa AA seqDB search
MTTLTTTTSPPSSPAPASSPRVTGTLRVTGTLGERYREILTPEALDFLTLLHDRFVARRH
ELLMDRQQRRQDVADGIDPDFRASTRPVRDDPSWRVAGSAGAPGLEDRRVEITGPTDPKM
TINALNSGAKVWLADAEDASSPTWRNVIEGQLALHDAIRGTLTHTTGSGEHRKEYRLRST
TLTDLPTIVFRPRGWHLIEKHMRYVDRAGVSVSASASLVDFGLYLFHNAHELVARGRGPY
FYLPKLEGHREARLWNDVFVLAQDYLGLPQGTIRATVLIETLPAAFEMEEILHELRDHCA
GLNAGRWDYLFSVIKAFRTRGDSYVLPDRAQVTMTAPFMRAYTELLVQTCHRRGAHAIGG
MSAFIPDRRRPDVTERAFEQVRADKRREATDGFDGTWVAHPDLIEVARTEFDAVLGDAPN
QVSRQRDDVRVGQHELLDIGSARRAGATVTAAGLRSNVSVGVRYLESWLRGVGAAAIDHL
MEDAATAEISRSQVWQWIASGTRTENGVPITRERVEALLAEIVDDLPRTPGNRIDDAAHV
FRAVALAEDFPTFLTIGAYSQFLVGSEVDQP
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctgaccacgaccacctctcccccgtcgtcccctgcccccgcgagcagcccg
cgggtcaccgggaccctgcgcgtcaccggcacgctgggcgagcgctaccgcgagatcctc
acgcccgaggcgctcgacttcctcacgctgctgcacgaccggttcgtggcgcgccgccac
gagctgctcatggaccgccagcagcgccgccaggacgtcgcggacggcatcgaccccgac
ttccgcgcctcgacgcggcccgtgcgcgacgacccgtcgtggcgcgtcgcgggctcggcc
ggcgcgccgggactcgaggaccgccgcgtcgagatcaccggcccgaccgaccccaagatg
acgatcaacgccctcaactccggcgccaaggtctggctcgcagacgccgaggacgcgtcg
agccccacgtggcgcaacgtgatcgagggccagctcgcgctgcacgacgcgatccgcggg
acgctgacgcacacgaccggctcgggcgagcaccgcaaggagtaccgcctgcgctcgacg
acgctcaccgacctcccgacgatcgtgttccgcccgcgcgggtggcacctcatcgagaag
cacatgcggtacgtcgaccgggcgggcgtgagcgtctcggcgtcggcgtcgctcgtcgac
ttcgggctgtacctgttccacaacgcgcacgagctcgtggcgcgcgggcgaggcccgtac
ttctacctgcccaagctcgaggggcaccgcgaggcccggctgtggaacgacgtgttcgtg
ctcgcccaggactacctcggcctgccgcagggcacgatccgcgccacggtgctcatcgag
acgctgcccgcggcgttcgagatggaggagatcctccacgagctgcgcgaccactgcgcc
gggctgaacgccgggcgctgggactacctgttctccgtgatcaaggcgttccgcacgcgc
ggcgactcgtacgtgctgcccgaccgcgcgcaggtcaccatgaccgcgcccttcatgcgc
gcgtacaccgagctgctcgtgcagacgtgccaccggcgcggcgcgcacgcgatcggcggc
atgagcgcgttcatcccggaccgccgtcggccggacgtcaccgagcgcgcgttcgagcag
gtgcgcgcggacaagcgccgggaggcgacggacgggttcgacggcacgtgggtcgcgcac
cccgacctcatcgaggtcgcgcgcaccgagttcgatgcggtgctgggggacgcgccgaac
caggtctcgcggcagcgcgacgacgtccgggtgggccagcacgagctgctcgacatcggg
tcggcccgccgggccggggccaccgtcaccgctgcggggctgcgctcgaacgtctccgtc
ggggtgcggtacctcgagtcgtggctgcgcggcgtcggggccgccgcgatcgaccacctc
atggaggacgccgcgacggccgagatctcgcggtcgcaggtgtggcagtggatcgcgtcc
ggcacgcgcaccgagaacggcgtgccgatcacgcgcgagcgcgtcgaggcgctgctcgcg
gagatcgtcgacgacctgccgcgcaccccggggaaccggatcgacgacgccgcgcacgtg
ttccgcgccgtcgcgctcgccgaggacttcccgacgttcctcaccatcggggcgtactcg
cagttcctcgtgggttccgaggtggaccagccgtag

DBGET integrated database retrieval system