KEGG   Clostridium estertheticum: A7L45_02400Help
Entry
A7L45_02400       CDS       T04811                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ceu  Clostridium estertheticum
Pathway
ceu00071  Fatty acid degradation
ceu00072  Synthesis and degradation of ketone bodies
ceu00280  Valine, leucine and isoleucine degradation
ceu00310  Lysine degradation
ceu00362  Benzoate degradation
ceu00380  Tryptophan metabolism
ceu00620  Pyruvate metabolism
ceu00630  Glyoxylate and dicarboxylate metabolism
ceu00640  Propanoate metabolism
ceu00650  Butanoate metabolism
ceu00900  Terpenoid backbone biosynthesis
ceu01100  Metabolic pathways
ceu01110  Biosynthesis of secondary metabolites
ceu01120  Microbial metabolism in diverse environments
ceu01130  Biosynthesis of antibiotics
ceu01200  Carbon metabolism
ceu01212  Fatty acid metabolism
ceu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7L45_02400
   00630 Glyoxylate and dicarboxylate metabolism
    A7L45_02400
   00640 Propanoate metabolism
    A7L45_02400
   00650 Butanoate metabolism
    A7L45_02400
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7L45_02400
   00072 Synthesis and degradation of ketone bodies
    A7L45_02400
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7L45_02400
   00310 Lysine degradation
    A7L45_02400
   00380 Tryptophan metabolism
    A7L45_02400
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7L45_02400
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7L45_02400
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7L45_02400
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ceu04147]
    A7L45_02400
Enzymes [BR:ceu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7L45_02400
Exosome [BR:ceu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7L45_02400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: APC38996
UniProt: A0A1J0GCC0
Position
502430..503611
Genome map
AA seq 393 aa AA seqDB search
MKEIVIVGAARTAIGSFGGGLSKVSAVEMGTVAAKEAIKRSGVKPELIEEAIIGNVIQAG
LGQNVARQIAIKAGLDISSSALTINKVCGSGLRAVSLAAQIIMCGDAEVVLAGGTESMSN
APYALPNNRWGARMGDGKVVDTMIKDSLWDAFNDYHMGMTAENIAEQWNITREDQDQFAL
KSQHKAEAAIKGGKFKDEIVPVVIPQRKGDPITFDTDEFPKFGSSIEKLRKLKPAFKKDG
TVTAANASGINDGAVMFIVMSKDKADQLGLKPLVTIKSYASAGVDPKIMGYGPVPASKKA
LAKAGLTVADLDLVEANEAFASQSLAVAKDLGLNPEIVNVNGGALALGHPVGASGGRILI
SLIYEMIKRDSKTGLATLCIGGGQGTAIIVERK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatagtaattgtaggagcagcaagaacagcaataggatcttttggtggagga
ttatcaaaagtatcagctgtagaaatgggaactgttgcagctaaggaagctataaaaaga
tcaggagttaaaccagaattaatagaagaagctataatcggtaacgtaatacaggcagga
cttggacaaaatgttgctaggcagatagctataaaagcaggattagatatttcatcttca
gcacttacaataaataaagtttgtggttcaggacttagagctgtaagtttagctgcacag
attataatgtgtggagatgcagaagtagttttagcaggtggaactgaaagcatgagcaac
gctccatatgcacttccaaacaatagatggggagcaagaatgggagacggtaaagtagtt
gatactatgattaaagattctctttgggatgcatttaatgactatcatatgggaatgaca
gcagaaaatattgcagaacaatggaacatcactagagaagaccaagatcaatttgcttta
aaaagtcaacataaagctgaagcagctataaagggtggcaaatttaaagatgagatcgtt
ccagtggtaattcctcaaagaaaaggggatccaataacatttgatactgatgaatttcca
aaatttggttcatctatagaaaaattaagaaaattaaaaccagcatttaagaaagatggt
actgtaacagcagctaatgcatcaggaataaatgatggtgctgttatgtttatagtaatg
tcaaaagataaagctgatcaattaggacttaaacctctagttacaataaaatcatatgca
tcagcaggagtagatccaaagataatgggttatggtccagttccagcaagcaaaaaagcg
ttagcaaaagcaggacttactgtagctgatttagatttagttgaagctaacgaagcattt
gcttctcaatcattagctgtagctaaagatttaggcttaaatccagaaatagtaaatgtt
aatggtggagctttagcactaggtcatccagtaggagcttcaggtggaagaatacttatt
tcattaatatatgaaatgataaaaagagattctaaaacaggacttgctacattatgtata
ggtggcggtcaaggaactgcaattattgttgaaagaaaatag

DBGET integrated database retrieval system