KEGG   Clostridium estertheticum: A7L45_05000Help
Entry
A7L45_05000       CDS       T04811                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
ceu  Clostridium estertheticum
Pathway
ceu00270  Cysteine and methionine metabolism
ceu00920  Sulfur metabolism
ceu01100  Metabolic pathways
ceu01110  Biosynthesis of secondary metabolites
ceu01130  Biosynthesis of antibiotics
ceu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    A7L45_05000
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A7L45_05000
Enzymes [BR:ceu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     A7L45_05000
    2.3.1.46  homoserine O-succinyltransferase
     A7L45_05000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: APC39467
UniProt: A0A1J0GDU8
Position
complement(1064842..1065759)
Genome map
AA seq 305 aa AA seqDB search
MPIKIPDNLPAYKTLNKENVFTITEDCAFHQDIRPLKIIILNLMPTKIDTETQLLRLLGN
SPLQIDIVLLHPESHDSKNISPEHLIKFYNTFDEIKDSKFDGMIITGAPIENVPFEEVDY
WDELKKIMDWSVRNVFSTLHICWGAQAGLYYHYGVQKHKLCKKLFGVFKHTATQKNVRLL
TGFDDEFYVPHSRHSEIKKVDIDKVDELKIISESDESGIYIVSAKKGRQIFITGHSEYDP
LTLKTEYDRDIANGLNIDVPKNYYPQDDPTKTPIVKWRGHSSLLFSNWLNYYVYQETPYN
LVYLE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccaataaaaataccagacaatcttccagcatataagactctaaataaagaaaatgtt
tttactattacagaagactgcgcatttcatcaagatattaggccattaaaaattataatt
ttaaacctaatgcctacaaagattgatacagaaacgcaacttctaagacttcttggtaac
tcaccacttcagattgatatagtgcttcttcacccagaaagtcatgacagcaaaaatata
tcacctgaacatttaattaaattttacaatacttttgatgaaataaaagattctaaattt
gatggaatgataataacaggagcacctattgaaaatgttccttttgaagaagtagattac
tgggatgagctaaaaaaaatcatggactggagcgtgcgcaatgtattctccaccctacat
atttgttggggtgcgcaagctgggctttattatcattatggagttcaaaaacataaacta
tgcaaaaaactgtttggagtatttaaacatacggcaacgcagaagaatgttaggctattg
actggatttgacgatgagttttatgttccgcattcaaggcattctgaaataaagaaagtt
gatattgataaagtcgatgaacttaaaattatatcagaatcagatgaatcaggaatttac
attgtatcagcgaaaaaaggacggcagatttttataacaggacattcagaatatgatcca
ttaacgctcaaaacagaatatgatagagatatcgcaaatggtttaaatattgatgtacca
aaaaattattatccacaagatgatccaactaaaacacctattgtaaaatggagaggtcat
tcaagtttactcttttcaaattggttaaactattacgtttaccaagaaaccccatataat
ctggtgtatttagaataa

DBGET integrated database retrieval system