KEGG   Clostridium estertheticum: A7L45_08140Help
Entry
A7L45_08140       CDS       T04811                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ceu  Clostridium estertheticum
Pathway
ceu00480  Glutathione metabolism
ceu00590  Arachidonic acid metabolism
ceu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A7L45_08140
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A7L45_08140
Enzymes [BR:ceu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A7L45_08140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF823
Motif
Other DBs
NCBI-ProteinID: APC40040
UniProt: A0A1J0GGD7
Position
complement(1775248..1775793)
Genome map
AA seq 181 aa AA seqDB search
MTIYDFKFKTIDGEDETLNQFKGKVLLIVNTASKCGFTPQYKDLQKLYEKHNAEGFEILG
FPSNEFAKQEPANNQEVKQFCEINFGVTFPLSEKVQVRGNNIHPLFKYLTSQLAFEGFDM
NDPSGKMISSVLKENFPEYLLDDSIKWNFTKFLIDRQGNVVGRFESPIEPMSIETQIQNL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacaatttatgactttaagtttaaaactattgatggcgaggatgaaacacttaatcaa
tttaaaggcaaggtgttattaattgtaaatactgcaagtaaatgcggttttaccccacaa
tacaaagatctacaaaaactctatgagaaacataatgctgaaggctttgaaatacttggt
tttccatctaatgaatttgctaagcaagaacctgcaaacaatcaagaggtaaaacagttt
tgtgaaataaattttggagtaactttcccactatcagaaaaggttcaggttagaggtaat
aacatccatcctttatttaaatatttaactagccaattagcatttgaaggatttgacatg
aatgatccaagcggcaaaatgatctcttcagttctaaaagaaaattttcctgaatattta
ttagatgattcaatcaaatggaattttactaaattcttaatagatagacaaggaaatgtt
gtaggaagatttgaatctcctattgaaccaatgagtattgaaacacaaattcaaaattta
ctttaa

DBGET integrated database retrieval system