KEGG   Clostridium estertheticum: A7L45_15670Help
Entry
A7L45_15670       CDS       T04811                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
ceu  Clostridium estertheticum
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7L45_15670
Enzymes [BR:ceu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     A7L45_15670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: APC41410
UniProt: A0A1J0GJ32
Position
3383088..3383921
Genome map
AA seq 277 aa AA seqDB search
MYNRGDFHLHTNASDGKLSPKELIHEASLNGLDIIAITDHDTTLNVEEGIREGINNNIRV
IPGIELSTVHNNESIHILGYFKDDEYKNLDFQNFLKDIEDSRVFRGRKIVENLDLFFKIK
LDYQKVLDQAKGVIARPHIAKAIIDAGYKYDWNYIFDTFLSNDSPAYVHIKRIPTADGIS
LLKKVNALVVLAHPVLIKKTSIDEMLGFDFDGIEAVYPINTKKQKSLLKAKAKEYNKFVT
AGSDFHGISTSDTGHGLVGCVSLSNEELAIFVNKLES
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtacaacagaggtgatttccatcttcatacaaatgcatctgatggaaaactaagtcct
aaggaattaattcacgaggcttctttaaatggattagatattattgcaataactgatcat
gacactactttaaatgtcgaggaaggaattagagaaggtataaataataatataagggta
atacctggtatagaattatctacagttcataataatgaaagcatccatattcttggatat
tttaaagacgatgaatataaaaatttagattttcaaaattttttaaaagatatagaggat
tctagagtatttagaggcagaaaaatagtagaaaatctagatctatttttcaaaataaaa
ttagactaccaaaaggttctagatcaagcaaaaggagtaatagctaggccacatatagct
aaagccataattgatgctggctataaatatgattggaactatatatttgatacttttctt
tcaaacgatagccctgcatatgtgcacattaaaagaattccaacagctgatggtataagc
ctattaaagaaggttaacgcattagttgtacttgcacatccagttttaattaaaaaaact
tctatagatgagatgttaggatttgattttgatggtattgaggcagtttatccaataaac
acaaaaaaacagaaatcgcttctaaaagcaaaagctaaagaatacaataaattcgttact
gccggttcagattttcatggaatttcaacatctgacactggtcatggacttgttggctgc
gtttccttaagtaatgaagaactagctatctttgtaaataaactagaatcataa

DBGET integrated database retrieval system