KEGG   Clostridium estertheticum: A7L45_16575
Entry
A7L45_16575       CDS       T04811                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
ceu  Clostridium estertheticum
Pathway
ceu00472  D-Arginine and D-ornithine metabolism
ceu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    A7L45_16575
Enzymes [BR:ceu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     A7L45_16575
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding AA_kinase
Other DBs
NCBI-ProteinID: APC41579
UniProt: A0A1J0GJT2
Position
complement(3574872..3577082)
AA seq 736 aa
MQEKLEENTKLNVEEILKDLDKYEPKWRGWHWREKNETGKVGEFTYHEISSPLKKSQPLP
AARSFGNIDPQPRATITTEIASGRFEDDIRRMRMAAWHGADHLMVIRTMGQSHFDGLLEG
SPEGFGGVPITRKEIRATRKAIDLIEEEVGRKINFHSYVSGVAGPDVAVMFAEEGVNGAH
QDPQYNVLYRNINMVRSFVDAAVAKGIMAHAGMLQIDGAHNANATAMKGYKVMPELMVQH
AINSCFSQLVGMKPENISLSTVPPTSAPAPCMRYDLPYAVALREFFKKYKMRAQMNTKYI
ESCEREATVGHTLNLLISELTSADIQSTITPDEGRNVPWHYNNIHAINTAKQAFIGMDGL
MDMIELKKTGYLPEKAREIQERAVLFFEEILEVGGYFKAVDSGFFIDSGQYPERNDDGIA
RKILGGDAVGTIVKRESDYFAPVCGHFGYNNIPKEYKKPCDAIDECTLCNHSKIVYIDEL
DDNDNVFKRMEKVKEDGTIIPEVQWAKDGYVKITLCIPENEQISEAAALEMGKRMNLKNV
EIVHKQVLQKAEGTLIEIKGVCDFTPIKRDELVLPKRRKSLSDQQMKDYVKQHPIKVVAA
TVGEDEHSVGVREVIDIKHGGVEKFGIEAIFLGTSCPIEKLVDAAIESKAQAILCSTIIS
HNDVHTKNMKKLSDLCIEKGVRDKIILVSGGTQVTDEIAKANGMDVGFGRGSNGTSVASF
IIKRLMGLPDNEEEEE
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgcaggaaaagctagaggaaaatacaaaacttaatgtagaagaaatattaaaggatcta
gataagtatgagcctaaatggagaggatggcattggagagaaaaaaatgaaactggaaaa
gttggtgaattcacatatcatgaaatatcatcgcctttaaagaagagtcaacctcttcca
gcagcaaggagctttggaaatatagacccacaaccaagagctactattaccacagaaatt
gcttcaggtagatttgaagatgatataagaagaatgagaatggcagcatggcacggtgcg
gatcatctaatggttattaggacaatgggacaaagtcattttgatggtttacttgaagga
agcccagaagggtttggtggggtaccaataactagaaaagaaattagagcaacaagaaaa
gctatagatttaatagaagaagaagtgggtagaaagattaattttcattcctatgtgtct
ggcgttgcaggtccagatgtagcagttatgtttgcagaagaaggggttaatggagcccat
caagatccacaatacaatgtactttatagaaatattaatatggttagatcttttgttgat
gctgcagttgcaaaaggcatcatggcacatgctggaatgcttcaaatagatggtgcgcat
aatgcaaatgcaacagctatgaagggttataaggtaatgccagaacttatggtgcaacat
gctataaattcttgtttttcgcagcttgttggaatgaaaccagaaaatatttctttatcg
acagtacctccaacatcagcaccagcaccttgtatgagatatgacttgccttatgcagtt
gctctaagggagtttttcaaaaaatataaaatgagagctcaaatgaatactaaatatata
gaatcttgtgaaagagaagctacagtaggacatactttgaatcttttaatatctgagtta
acatcagcagatattcaaagtacaataactcctgatgaaggacgtaatgttccttggcat
tataataatattcatgctattaatacagctaaacaggcatttataggtatggatggatta
atggacatgatagagcttaagaaaacaggatatttaccagaaaaggcaagagaaattcag
gaaagagctgttttgttctttgaggaaatattagaggttggtggatactttaaagctgta
gattctggattttttattgactcaggtcagtacccagaaagaaatgatgatggtattgca
agaaaaattttaggtggagatgcagtcggaacaatagttaagagagaatcagattatttt
gcaccggtttgtggtcattttggatataataatattcctaaagagtataaaaaaccttgt
gatgctattgacgaatgtaccttgtgtaatcattctaaaattgtatacatcgatgaatta
gatgataacgataatgtatttaagagaatggaaaaagttaaagaagatggtactataatt
cctgaagttcaatgggcaaaagatgggtacgtaaaaatcactttatgtataccggaaaat
gaacagattagtgaggcggcagcccttgaaatgggcaagagaatgaatttgaaaaatgta
gaaattgttcataaacaagtgttacaaaaggctgaaggaaccctcattgaaataaaagga
gtatgtgattttacacctataaaacgtgatgagttagttcttccaaagagaagaaaatca
ctatcagatcaacaaatgaaagattatgtaaagcagcatccaataaaggttgttgcagca
actgttggggaagatgaacattcagttggagttcgtgaagtcattgatattaaacatggt
ggagttgaaaaatttggtatagaagcaatttttcttggaacttcatgcccaatagaaaaa
cttgtagatgcagctatagagtcaaaagctcaggcgatactatgtagtacaataattagt
cataatgatgttcatacaaagaatatgaaaaaacttagtgatctttgtatagaaaaggga
gtaagagataagattatacttgtttcaggtggtacacaagtaacagatgaaatagctaaa
gcaaacggaatggatgttggttttggacgtggatcaaacggcacctctgttgcctcattc
ataattaaaaggttaatgggtcttcctgataatgaagaagaggaagaataa

DBGET integrated database retrieval system