KEGG   Clostridium estertheticum: A7L45_16580
Entry
A7L45_16580       CDS       T04811                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
ceu  Clostridium estertheticum
Pathway
ceu00472  D-Arginine and D-ornithine metabolism
ceu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ceu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    A7L45_16580
Enzymes [BR:ceu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     A7L45_16580
SSDB
Motif
Pfam: OAM_alpha
Other DBs
NCBI-ProteinID: APC41580
UniProt: A0A1J0GJN6
Position
complement(3577082..3577447)
AA seq 121 aa
MKREDDFEKRREHLKNLTNDQLYDRFWSLTNQVVKPMVDLAYTHTSPAIERSVVLRMGFS
SLQAQPIISYGTKWNLLGKGIGNVILTYAKLKNIDYIKAGVELSKGIGWDVVSEKMKGSD
N
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaaagagaagatgatttcgagaaaagacgagaacatttaaaaaatttaacaaatgat
caattgtatgacaggttttggagtcttacaaatcaagtagtaaaacctatggttgattta
gcatatactcatacgtcaccagctattgaacgttctgtagtacttagaatgggcttttct
agtttgcaagctcagcccataatatcttatggaactaaatggaacttacttggcaagggg
ataggaaatgtaattttaacttatgcaaagcttaaaaatattgattatattaaagcagga
gtggaactttctaaaggaataggctgggatgtcgtatctgaaaaaatgaaaggaagtgac
aattaa

DBGET integrated database retrieval system