KEGG   Cellulosilyticum sp. WCF-2: EKH84_08580Help
Entry
EKH84_08580       CDS       T06333                                 

Definition
(GenBank) hypothetical protein
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
cew  Cellulosilyticum sp. WCF-2
Pathway
cew00410  beta-Alanine metabolism
cew00770  Pantothenate and CoA biosynthesis
cew01100  Metabolic pathways
cew01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cew00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EKH84_08580
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EKH84_08580
Enzymes [BR:cew01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     EKH84_08580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: QEH68426
Position
1940502..1941344
Genome map
AA seq 280 aa AA seqDB search
MDIMTSLEAMTAKLDRIGRRSIGLIMTKGALHEGHIALIKAARAENEYIIVSSFLHSHEF
SSEEAYKLYPRQVEEDQEIASKAGVDFFFCPSYEGLYPNGSSTYVSIYTPLMNRLEGQIH
PKYYQSFLTTANLLLSCIRPQRYYISEKDFQKKALLSQLIRDFHYVCEIRVLPTEREADG
LIIGSRNTLLEPEERRLAPLLYHTLKKAELAYQRGNISSYKLKLLLETEIKRYYRIQLEY
VDVLEIERLTSIETIIEEALIVMSIRLGSVRLSDYIYLKK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggatattatgacatcattagaagctatgacagctaagctcgatcgcataggtaggagg
tctataggccttattatgacaaagggtgctttacatgaagggcatatagctttgataaaa
gcagcaagagctgaaaatgaatatattatagtaagtagtttcttgcattcacatgagttt
tcttctgaagaagcttataagctctatcctagacaggtggaggaagatcaggaaatagct
agtaaagcaggagtagactttttcttttgtccaagttatgaaggactttatcctaatggt
agtagtacttatgtaagtatctatacaccacttatgaatcgtcttgagggtcaaatacat
cctaagtattatcaaagctttttaactacggcaaatttactactaagttgtattagacca
cagcgttactatatcagtgaaaaggattttcaaaaaaaagccctacttagtcagcttata
cgtgattttcactatgtttgtgaaataagagtcttacctaccgagagagaagcagatgga
cttattataggaagtagaaatactttattagagccagaagaaaggcgattagcaccgctt
ctttatcatacgcttaaaaaagcagagttagcttatcaaagaggaaatattagtagttat
aagcttaaattacttttagagacagaaataaagcgctattatcgtattcagctagaatat
gtggatgtgttagaaatagaacgcctaacaagtatagaaaccattattgaagaagcgctt
atagtaatgagtatacgtctagggagcgtaaggctttcagattatatttatcttaagaaa
taa

DBGET integrated database retrieval system