KEGG   Caldisericum exile: CSE_03730Help
Entry
CSE_03730         CDS       T01804                                 

Gene name
pepV
Definition
(GenBank) putative peptidase PepV
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cex  Caldisericum exile
Pathway
cex00300  Lysine biosynthesis
cex01100  Metabolic pathways
cex01120  Microbial metabolism in diverse environments
cex01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    CSE_03730 (pepV)
Enzymes [BR:cex01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CSE_03730 (pepV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: BAL80499
UniProt: I0GIB2
Position
complement(360674..362002)
Genome map
AA seq 442 aa AA seqDB search
MEKFIDENKQRLVEITQEIIRIPSVEDNPTEGAPFGENVKNALLLALQISKDLGFRTVNI
DNIVGYAEFGEGKDVISVLGHLDVVPEGTGWTYPPYGAEIHDGKIYGRGAIDDKGPTMAA
LFGAYTLKETGAKLSKRIRIVFGTNEETGWKCMAHFKNVVHDPLIGFTPDAEFPLINREK
GILNVTLRSDFNSKNEEVKITGGNRPNMVPDYAKAEFNDEVYLKDLEEGVEVKGTIVEAH
GKSAHGALPEQGVNAIVKLSNAIVDVVKHPEVKKVLEFIVKHVGTDVYGGLMGIANVDSL
SGKLTMNLGVIEINESSGILTFNIRYPISDNFERIIYGFNKVAEVYGLKVSEYRNQNPLY
VKEDSELVKILLNVFEKTTGRKGYTLSIGGGTYARAMDLGVAFGPTFEEMEKVEHMANEY
IAIDHLVNLAKIYGNALYELAK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattcatagacgaaaataagcaaaggcttgttgaaattacacaagaaatcatt
aggattccaagtgtagaagataatcctacggaaggagctccatttggagaaaatgtgaag
aatgcacttttgcttgcacttcaaatttcaaaagatctcggttttagaacagttaacatt
gataatattgtgggatatgcagaatttggagaagggaaagatgtaataagcgtacttgga
caccttgatgttgttcccgagggaactggttggacttatccaccgtatggagcagaaatt
cacgatggaaaaatctacggcagaggcgctatcgacgacaaaggcccaacaatggctgca
ctttttggtgcatatactcttaaagaaaccggggcaaaactttcgaaaagaataagaatc
gtttttgggacaaacgaggaaacaggctggaaatgtatggcacatttcaagaatgtagtc
catgacccacttattggctttacccctgatgcggaatttcccttgattaacagagaaaaa
ggaattttaaatgtaacactacgaagtgattttaattcaaaaaacgaagaagtaaaaatt
actggtggaaaccgtccaaatatggtgcccgactacgcaaaggcagagtttaatgatgaa
gtttatttaaaagatcttgaagaaggagttgaagtaaaaggaacgattgttgaggcgcat
ggaaaatctgcgcacggtgctctcccagagcagggggtaaatgcaattgttaaactgtca
aatgcaatcgtcgatgtagtaaaacatccggaagttaaaaaagttcttgaatttatagtt
aaacatgttggaactgatgtctacggcgggctcatgggtattgcaaatgttgattctctt
tcaggaaaattaacgatgaacttaggcgtaattgaaataaatgaatcttcgggaatatta
actttcaacataaggtatccaatctctgacaattttgagcgtattatttatggctttaat
aaggtggcagaagtttacggcttgaaggtttcagaatatagaaatcaaaatcctctttat
gtaaaggaagactcggagttagtaaaaatacttcttaacgtatttgaaaagacaacggga
agaaaaggttatacgctttcaattggtggcggtacatacgcaagagcgatggatttaggt
gttgcctttggcccaacattcgaggagatggagaaagttgaacatatggcaaatgaatat
atcgcaatagaccatcttgtgaatttagcaaaaatctatgggaatgcactctacgaactt
gcaaaatag

DBGET integrated database retrieval system