KEGG   Caldisericum exile: CSE_07990Help
Entry
CSE_07990         CDS       T01804                                 

Definition
(GenBank) putative 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cex  Caldisericum exile
Pathway
cex00010  Glycolysis / Gluconeogenesis
cex00030  Pentose phosphate pathway
cex00051  Fructose and mannose metabolism
cex00052  Galactose metabolism
cex00680  Methane metabolism
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01120  Microbial metabolism in diverse environments
cex01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CSE_07990
   00030 Pentose phosphate pathway
    CSE_07990
   00051 Fructose and mannose metabolism
    CSE_07990
   00052 Galactose metabolism
    CSE_07990
  Energy metabolism
   00680 Methane metabolism
    CSE_07990
Enzymes [BR:cex01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CSE_07990
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CSE_07990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAL80925
UniProt: I0GJI8
Position
781814..782830
Genome map
AA seq 338 aa AA seqDB search
MRIGVLTGGGDCPGLNPAIRGVVYRAFDFGDEVIGFEEGWKGLIEDKKRQLSIKDVEEII
NYGGTILYTSRTNPFKEEHGPEKVIETLKKNNIDALIAIGGDDTLSVALKLHKLGVKVVG
VPKTMDNDLSQTDYTFGFFTSVEVAVDALNRLRDTAKSHKRIIVLEVMGREAGWVALFTG
IAGAADWILIPEEKPDYDKMCEHLKKKYEEKGYALVVVSEGIEIPTETTTEVDEFGHALL
QKRGVHEYVADLISKKLGISTRSAIIGHIQRGGPPTVFDRILATRVGVKAVEMVHEGDFG
KMAAISGNKVIAVPLEDAAGKQKLVDEEWIKFMKVFEK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaggattggtgttctaacgggtggtggcgattgtccagggttaaatcctgcaattaga
ggcgtggtttatagggcatttgattttggagatgaagtcattggttttgaagagggctgg
aaaggccttattgaagacaagaaaaggcaactttccataaaagatgtagaggaaattata
aattacggcggtacgattctttatacatcaagaacaaatcctttcaaggaagaacacggt
ccggaaaaggtaattgaaactctaaagaaaaacaatattgatgcattaattgcaataggt
ggagacgatactctttctgttgcactaaaacttcacaaactaggggttaaggttgtagga
gttccaaaaactatggataatgatctatcacagaccgactacacctttgggttctttact
tccgttgaagttgcggtggatgctcttaataggttaagagatacagcaaaatctcataag
agaattattgttcttgaggtaatgggaagagaagcaggttgggttgcactttttacagga
attgctggtgctgccgattggattttgattccagaagaaaagccagattacgataagatg
tgtgagcatctaaagaagaagtatgaggaaaaaggttatgctcttgttgtggtatccgag
ggtattgaaattccaaccgaaacaactaccgaagtagatgaatttggacacgcacttctc
cagaagagaggtgttcatgaatatgttgccgacttaatatctaaaaaacttggaatctct
acgcgtagcgcaatcataggacatatacaaagaggaggtcctccgacggtattcgatcgt
attcttgctacacgtgttggtgtaaaggctgtagaaatggtacatgaaggcgactttgga
aagatggctgcgatttctggaaacaaagtcattgcagttcctcttgaagatgcagcgggt
aaacaaaaactcgttgatgaggaatggattaaatttatgaaagtttttgaaaaatga

DBGET integrated database retrieval system