KEGG   Caldisericum exile: CSE_10200Help
Entry
CSE_10200         CDS       T01804                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cex  Caldisericum exile
Pathway
cex00020  Citrate cycle (TCA cycle)
cex00640  Propanoate metabolism
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01120  Microbial metabolism in diverse environments
cex01130  Biosynthesis of antibiotics
cex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cex00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSE_10200 (sucC)
   00640 Propanoate metabolism
    CSE_10200 (sucC)
   00660 C5-Branched dibasic acid metabolism
    CSE_10200 (sucC)
Enzymes [BR:cex01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CSE_10200 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A OKR_DC_1_N
Motif
Other DBs
NCBI-ProteinID: BAL81146
UniProt: I0GK59
Position
complement(1000678..1001814)
Genome map
AA seq 378 aa AA seqDB search
MNLQEYQSREFFERFGIQVVVGDVASNPEEALGIAKKIGLPVVLKAQVLVGGRGKAGGVK
VAKTEEDVLKLAGEILSMEIKGLKVRKLLVAKAVNIVKEFYVGFTVDRGSKKNVLIVSEA
GGVDIEEVAKNTPEKIYKIYIDPIMGLFSYEAKKASLLLTRDMNIAPKIADIIERLYKVY
ISLDANLAEINPLAVVDNSVVLALDAKIVIDDNAMFRHPELEDLREPTEEEKLELEAKSK
GFTYIKLNGNIGCLVNGAGLAMATMDLIKLFGGEPANFLDIGGSSSPDKVANAIEMITRD
KNVKAILINIFGGITRCDDVANGLLKALDMTKVDVPIVVRLTGTNEDKAKEILKDTPLIY
TDSMVEGVKKVVEVANAR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcaggagtatcaatcaagagaatttttcgaaagattcggcatccaagtagtt
gttggggatgttgcaagcaatccggaagaagcattaggaattgcaaaaaaaattgggcta
cctgttgttttgaaggcccaggttttagttggaggtcgtggaaaagcaggtggtgtaaaa
gttgcaaaaactgaagaagatgttttaaaacttgcaggcgaaattctttcaatggaaata
aaaggtttaaaggttaggaaattacttgtcgcaaaagcagttaatatagttaaggaattt
tacgttgggtttaccgtggatagaggaagcaaaaagaatgttttaattgtatcagaagca
ggcggtgttgatattgaagaggttgcaaaaaatactcctgaaaaaatctacaaaatttat
attgatcctattatgggtcttttttcttatgaagcaaagaaggcctctttgttgcttaca
agggatatgaatattgcacccaagatagcagacatcattgagagattatataaggtttat
atttcacttgatgcgaatcttgccgagattaatcctcttgcagtggtagataacagcgtt
gttttagcacttgatgcaaaaattgttattgatgacaatgcgatgtttagacatcccgaa
cttgaggaccttagagagcctacagaagaagagaagcttgaacttgaagcaaagtcaaaa
ggtttcacttacataaagttgaatggaaatattggttgtcttgtaaacggagcaggtctt
gcaatggctacgatggaccttataaagctctttggtggagagcctgcaaacttccttgat
attggaggttcatcttctcccgataaagttgcaaatgcaattgaaatgattacacgagat
aaaaacgttaaggcgattcttataaacatttttggtggaatcactcgctgtgatgatgtg
gcaaacggtcttctaaaagcacttgatatgacaaaggttgatgttccgatagttgtaagg
cttactggcacaaacgaggacaaagcaaaagagatacttaaagatacacctcttatttat
accgattcaatggttgaaggtgttaaaaaagttgttgaagttgcaaatgcgaggtga

DBGET integrated database retrieval system