KEGG   Caldisericum exile: CSE_13390Help
Entry
CSE_13390         CDS       T01804                                 

Gene name
gcvT
Definition
(GenBank) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
cex  Caldisericum exile
Pathway
cex00260  Glycine, serine and threonine metabolism
cex00630  Glyoxylate and dicarboxylate metabolism
cex00670  One carbon pool by folate
cex01100  Metabolic pathways
cex01110  Biosynthesis of secondary metabolites
cex01130  Biosynthesis of antibiotics
cex01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cex00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CSE_13390 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CSE_13390 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CSE_13390 (gcvT)
Enzymes [BR:cex01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     CSE_13390 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C GTP_EFTU_D4
Motif
Other DBs
NCBI-ProteinID: BAL81465
UniProt: I0GL28
Position
1299677..1300798
Genome map
AA seq 373 aa AA seqDB search
MENLKRTPLYEEHLKLGAQMIPFAGYEMPLKYTSIKEEHLNVRMQVGIFDVSHMGEIEIH
GPDALKFAHYLVTNSVLDMKIGRVKYTPMCYEHGGEVDDLFVYNLGENFVLLVVNASNYE
KDLKFVLDHKENFNVEIIGKTDDYGEVAIQGPKAEEFLKNYFESTTPLEKLGYFKATYGK
LFGYDVIISRTGYTGEDGFEVYASPKDIVSIWNEALNKGKPFGIKPAGLGARDSLRFEVC
YWLYGNDIDETTNPFEAGQDFAVKMDKEDFIGKSSLENIQKVGIKRKLTGFKVLSGGVPR
HGMKIYNKDGVEIGYITSGNMSFIRNEILALGYVKLEYRDLGTRLTVKDGNRIFEIEIIE
APFIEPKAGKKKV
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcttaaaagaacacctctttatgaagagcatcttaaacttggtgcacaaatg
attccctttgcagggtatgaaatgcctttaaaatatacaagtatcaaagaagagcaccta
aatgtaagaatgcaagttggtattttcgatgtatcacacatgggtgaaatagaaattcat
ggtcccgatgcactaaaatttgcacactaccttgtcacaaatagcgtgcttgatatgaaa
ataggaagggtaaaatacacgcctatgtgctatgagcatggtggtgaggttgacgactta
tttgtctataaccttggagaaaattttgttcttcttgttgtaaacgcttcaaactacgag
aaagacctaaaatttgtactcgaccataaagaaaactttaatgttgaaattattggaaaa
actgatgattatggcgaagttgcaatacagggaccaaaggcagaagaatttttgaaaaat
tactttgaaagcacaacccctttggaaaaacttggatattttaaggcaacatatggaaaa
ctctttgggtatgatgtaattatttcaagaacaggctataccggtgaagatggttttgag
gtatatgcaagcccaaaggacattgtttcaatttggaatgaagcactcaacaaaggaaaa
ccctttggtattaagcccgctggccttggtgcaagagattctttgagatttgaagtgtgc
tattggctctatggaaacgatattgacgaaacaacaaacccttttgaagcaggacaggac
tttgcagtgaaaatggacaaggaagattttattgggaaatcctccttagaaaatatccaa
aaagttggtatcaaaagaaaattaacaggttttaaagtgctttcaggtggagtgccccgg
catggaatgaagatttacaataaagatggcgttgaaattggatacataacttcgggtaat
atgtcgtttattagaaatgaaatccttgctcttggatatgttaaattggaatatagggat
ttaggaacgcgattaactgtaaaggatgggaatagaatctttgaaatcgagattattgaa
gcaccattcattgaacccaaagcaggcaagaaaaaagtttga

DBGET integrated database retrieval system