KEGG   Coxiella mudrowiae: CleRT_05780Help
Entry
CleRT_05780       CDS       T03998                                 

Gene name
putA
Definition
(GenBank) Proline dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
cey  Coxiella mudrowiae
Pathway
cey00250  Alanine, aspartate and glutamate metabolism
cey00330  Arginine and proline metabolism
cey01100  Metabolic pathways
cey01110  Biosynthesis of secondary metabolites
cey01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cey00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CleRT_05780 (putA)
   00330 Arginine and proline metabolism
    CleRT_05780 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cey03000]
    CleRT_05780 (putA)
Enzymes [BR:cey01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CleRT_05780 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     CleRT_05780 (putA)
Transcription factors [BR:cey03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    CleRT_05780 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH LuxC
Motif
Other DBs
NCBI-ProteinID: AKQ33468
UniProt: A0A0H4UWU5
Position
607420..610563
Genome map
AA seq 1047 aa AA seqDB search
MTDITQLFFEKPFDPDWIRPTLNEAYRMDETARIKQLLELINFTPAIERAVSQLAEKLVI
AVREKEKEKGGIEGFMMHYDLSTEEGILLMCLAEALLRVPDKQTENLLIRDKLISAEWNK
YVGASESAFVNFARWGLALSGKILKKEKDGQLKTIWSNLIRKSGEPVIRKAIREAMKLMS
EHFVLGRTIEEAIKRSQIALKEGFRYSYDMLGEVARTQSDADRYYDSYYYAISALGKSHD
TQNIYEAPSISVKLSALYPRYDFKKREEAVPFLIERVKELVLHAKAQKIGMTIDAEEADR
LDMCLDIFKGLFTDNAFSGWEGLGLAVQAYQKRALPLIEWLIELSHQQKRRIPVRLVKGA
YWDSEIKLTQMEGLINYPVFTRKVNTDISYIACAKKMLSAQDALYPQFATHNAYSVAAIL
TLMDPRYEDYQFEFQNLQGMGKALHHYVVTKLNLPCRIYAPVGYYEDLLPYLVRRLLENG
ANSSFVNRIADKTVPISYLIKSPVEKIETLGEIPNPKIPLPRNLFAKARLNSIGRDLSNY
AELKPLAESIHNALEKTWQASPFLREIKKGKAVFDPADNRRQIGVIELADESDVEKAIII
GSSAFPAWDQKGVDARANIMRKMADLLEEHQAELMALVVREGGRTLQNALSEVREAIDFC
RYYAEQGEKQLNDTVFLGYTGENNVLRMNGRGIILCISPWNFPVAIFTGQIAAALVTGNA
VIAKPSGETPLTAAKVTHLFHEAGVPAEILQLMPSPGGTVGQALIENPKISGIIFTGSDN
TARHIQKTLANRSGPIVPFVAETSGINAMIVDSTALPEQLVQDVIVSAFDSAGQRCSALR
ILYVQDDIADNVIKMLAGAMAEIKIGDPMLLTTDVGPVIDAKAQATLQKHAAFMQKEGKL
IYKVDLPLAATHGTFVAPQAYELSSLNLIKDEVFGPILHVLRYRRQDLDKVIDDINGLGY
GLTFGIQSRIDETIDYIQRRINAGNIYVNRNMIGAVVGVQPFGGSWLSGTGPKAGGPHYL
PRYCVESTLTVNTTAAGGNTSLMAMED
NT seq 3144 nt NT seq  +upstreamnt  +downstreamnt
atgactgatataacccaacttttttttgagaaaccattcgatcctgactggatacggccg
acattaaatgaagcctatcgaatggatgaaactgctcgtataaagcaattattggaattg
attaattttaccccagccattgaacgtgctgtgagtcaattggcagaaaaattagtcatc
gccgtgcgggaaaaggaaaaagagaagggtggtatcgaaggctttatgatgcattatgac
ctttctaccgaggaaggaattttattaatgtgtcttgcggaagctttattacgtgtccca
gataaacaaactgaaaatttattaattcgggataaattgatcagtgcggaatggaataaa
tatgtgggtgcgagtgaatccgcctttgtgaattttgctagatggggattagcgctttca
ggaaaaatattaaaaaaagaaaaagacggacaattaaaaaccatttggagtaatctcatc
cgaaaaagtggcgaacctgttattcgcaaagcgatccgtgaagcaatgaaattaatgagc
gagcattttgttttaggccgtactattgaagaggctattaagcgctcgcagatcgcttta
aaagagggttttcgatattcttacgacatgttgggcgaagtggcacgaacgcagagcgat
gctgatcgatattatgattcctattattatgccattagcgctttaggaaaaagtcacgac
acacaaaacatttacgaagcgccgagtatttccgttaaattatctgcattgtatcctcgc
tatgattttaaaaaacgcgaagaagcagtaccttttttaattgaacgcgtaaaagaattg
gttctgcatgcaaaagcacagaaaattggcatgactattgacgcggaagaagccgatcga
ttagatatgtgcctggacattttcaaaggattattcacagacaatgctttttctggatgg
gaaggtcttggcctcgctgtccaagcttatcaaaagcgcgctttgccattaattgaatgg
ttaattgaattgagccaccaacaaaaacgccgtattcccgttcgtctggtgaagggagct
tattgggattccgaaataaagctaactcaaatggaaggattgattaattaccctgttttt
acgcggaaagtgaatacggatatttcttatattgcttgcgcaaagaagatgttaagtgct
caagacgctctttatccgcaatttgctactcataacgcctattcggttgcagcgatttta
acactaatggatcctcgttatgaggattaccaatttgagttccaaaatctacagggtatg
ggtaaggctttacatcattatgtcgttacaaaattaaatctgccctgccgaatttatgcg
ccggtagggtattatgaagatttgctgccttatctcgttcggcgattattagaaaatgga
gctaatagttcgtttgtcaatcgaatcgcggataaaacggtgccaatttcctacctgatc
aaaagcccggttgaaaaaattgagacgttgggagaaattcctaatcctaagattcccttg
cctaggaatctctttgctaaagcgcgattaaattcaataggaagagatttaagcaattat
gcggaattaaaacctctagctgaatcgatccataatgcactagaaaaaacgtggcaagca
tcgccattcttacgtgagattaaaaagggtaaagctgtttttgatccggccgataatcga
cgccagattggtgtgattgaattagcagatgaatccgatgtagaaaaagccattataatc
gggtcttcggctttccccgcctgggatcagaaaggggtagacgcgcgcgctaacattatg
cgaaaaatggcggacttgttagaagaacatcaagccgaattaatggccttggttgtgcgt
gaaggaggaaggactctccaaaatgccttatcggaagttcgcgaggctattgatttttgt
cgttattatgccgagcagggtgaaaaacagctaaatgacacagtgtttctgggttacact
ggagaaaacaatgtgctgcgaatgaatggtcgcggtattatcttgtgtattagtccctgg
aattttccggtagctatatttacaggacaaatcgctgcagcgttagtaacggggaatgcc
gtaattgctaagccctcgggagaaacacctttaacggcagccaaggtcactcatttattt
cacgaagcaggtgtgcctgcagaaattttacaattaatgccaagtcctggaggaactgta
gggcaagcattaattgaaaatcccaaaatcagcggaattatatttacgggttctgataat
accgcccgtcatattcaaaaaacattagctaatcgatctgggcccatcgtcccctttgtg
gcagaaacatctggtattaatgccatgatagtggattcaacggcactgcccgaacaattg
gttcaagatgtgattgtttctgctttcgatagcgcaggccaacgttgttctgctcttcgc
attttatatgttcaggatgatattgccgataatgtaataaaaatgttagcaggtgcgatg
gccgaaattaaaataggggatcccatgttattaaccaccgatgtgggacccgttattgat
gctaaggctcaagcaactttgcaaaaacatgctgcttttatgcaaaaagaagggaaatta
atttacaaagttgatttgcccctagcagcaactcatggaacatttgtagctccccaagct
tatgaattatctagcttaaacttgattaaagacgaggtttttggacctatcttgcatgtt
ctgcgatatcgacgccaggatctggataaagtgatagacgatattaatggtttgggatat
gggctcacctttggcatccagagccgtatcgatgaaacgatagattatattcagcgtcgt
attaatgcaggtaatatttatgtcaatcgcaatatgattggggctgtcgtaggtgttcag
ccttttgggggaagctggttatccggcacagggcctaaagccggtgggccgcattatttg
cctcgttattgcgtagaaagcacgttgacggtcaatacaacagccgctggtggaaacacc
tctttgatggcgatggaagactaa

DBGET integrated database retrieval system