KEGG   Cellulomonas sp. PSBB021: CBP52_02665Help
Entry
CBP52_02665       CDS       T04985                                 

Definition
(GenBank) dihydroxyacetone kinase subunit DhaK
  KO
K05878  phosphoenolpyruvate---glycerone phosphotransferase subunit DhaK [EC:2.7.1.121]
Organism
cez  Cellulomonas sp. PSBB021
Pathway
cez00561  Glycerolipid metabolism
cez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cez00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CBP52_02665
Enzymes [BR:cez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.121  phosphoenolpyruvate---glycerone phosphotransferase
     CBP52_02665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dak1 Ribosomal_L11
Motif
Other DBs
NCBI-ProteinID: ASR54227
UniProt: A0A222X5W0
Position
589291..590286
Genome map
AA seq 331 aa AA seqDB search
MKKLINDPAHVVSETLDGFGAAHADVVAVHHDPDHVTRAGGAVPGKVGLVSGGGSGHEPL
HAGFVGVGMLDAAVPGAVFTSPTPDQILPALQAADGGAGVLAIVKNYTGDVLNFETAVEL
AEAEDVAVRTVVVDDDVAVQDSLYTAGRRGVAGTVAVEKIAGAAAERGDDLDAVEAVARK
VVANVRSMGVALTACTVPHAGKPSFDLPEDEIEIGIGIHGEPGRRRIPLASADEITQMLL
APVADDLGLASGEDVLLLVNGMGGTPASELYIVYRKARELLEARGVNVTRSLVGNYVTSL
EMQGASVTVLRLDDELTTLWDAPVHTTALRW
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagctcatcaacgacccggcacacgtggtcagcgagacgctcgacgggttcggc
gccgcgcacgcggacgtcgtcgcggtccaccacgacccggatcacgtcacgcgcgccggc
ggtgcggtgcccggcaaggtcgggctcgtcagcggcggcggcagcgggcacgagccgctg
cacgcgggcttcgtgggcgtcgggatgctcgacgcggcggttcccggggcggtgttcacg
agcccgacgcccgaccagatcctcccggccctccaggccgccgacggcggcgcgggcgtg
ctcgcgatcgtgaagaactacacgggcgacgtgctgaacttcgagaccgccgtcgagctc
gccgaggccgaggacgtcgcggtgcgcacggtcgtcgtcgacgacgacgtcgcggtgcag
gactcgctctacacggccggccggcgcggggtcgcgggcacggtcgccgtcgagaagatc
gcgggcgcggcggccgagcgcggcgacgacctcgacgcggtcgaggcggtcgcgcgcaag
gtcgtcgcgaacgtgcgctcgatgggcgtcgccctgacggcgtgcacggtcccgcacgcg
ggcaagccgtcgttcgacctgcccgaggacgagatcgagatcggcatcggcatccacggc
gagcccggccgccggcgcatcccgctcgcgagcgcggacgagatcacgcagatgctgctc
gcaccggtcgccgacgacctcggcctcgcgtccggcgaggacgtcctgctgctcgtcaac
ggcatgggcggcacgcccgcgtccgagctgtacatcgtgtaccgcaaggcgcgcgagctg
ctcgaggcgcggggcgtgaacgtcacgcgctccctcgtcgggaactacgtgacgtccctg
gagatgcagggcgcgtcggtcacggtgctgcggctcgacgacgagctcaccaccctctgg
gacgccccggtgcacaccaccgccctgcgttggtga

DBGET integrated database retrieval system