KEGG   Cellulomonas sp. PSBB021: CBP52_14245Help
Entry
CBP52_14245       CDS       T04985                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cez  Cellulomonas sp. PSBB021
Pathway
cez00450  Selenocompound metabolism
cez00970  Aminoacyl-tRNA biosynthesis
cez01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cez00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CBP52_14245
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CBP52_14245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cez01007]
    CBP52_14245
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cez03016]
    CBP52_14245
Enzymes [BR:cez01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CBP52_14245
Amino acid related enzymes [BR:cez01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CBP52_14245
Transfer RNA biogenesis [BR:cez03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CBP52_14245
 Prokaryotic type
   Other AARSs
    CBP52_14245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g Cupin_2 AraC_binding tRNA-synt_1f MannoseP_isomer tRNA-synt_1 Cupin_3 CENP-C_C DMSP_lyase Cupin_7 Cupin_1
Motif
Other DBs
NCBI-ProteinID: ASR56062
UniProt: A0A222XD04
Position
3107174..3109213
Genome map
AA seq 679 aa AA seqDB search
MFTRAFDRSAMTWSYEMHLQPMLSATDIEGLPFGSVFGSVPGHTVSKRHAHQDGEVFVVL
AGRAVVVVGDEQRELGAGETVFIPPFSAHEIRNGRDEPFDIVSIYWEHIPSAVEVLGRQP
AADKVADRTLVACPPVTPNGGLHLGHLSGPYVRADMLVRALRSQGREARHLTGTDDQQSY
VAAHARVTGATSTDVALAAGDGIVATLAAADVRVDRVTRPLRDAGHAERIRELFARVAAA
PTVEERERETPYCPACDLSLHQAFARGTCAHCDAASDGEICEACGRPNEARELVDLRCRA
CDGPAELRTERALWLDLAAHADELRAYLRSVHASPDLMVLVERLLDEGLAPYRLTRTSDW
GITLDDGQAIDAWVDLALTFLAAVQAEADEHGPARTVLFLGYDNSYYYAVLLPVLAIAAG
LTEHLPATFVTNQFLHLGAEKFSTSRGHAVWADDALRASGPDALRVALLRDAPEGRVTHL
DEERAVSLTQDPLHRAARAWLAGFAGIGADGVVPGTGAWTDAHREFYRYLGLVTQQLDGL
LLPESFSARGYVRLLDAFVERCAEFRATETVARTVGSLAEEARTSLALEFLAAKVFAALV
WPLAPRTALAVWRWIGLEGEPVRESGWTFLPGGTRCDGPAPRVDEAASDEAASDEAPVDA
AGGETAPDEERELVASGRA
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccgcgccttcgaccgatcggccatgacctggtcctacgagatgcacctgcag
cccatgctctcggccaccgacatcgagggcctgcctttcggctcggtgttcggcagcgtg
cccgggcacaccgtgtccaagcgccacgcgcaccaggacggcgaggtcttcgtcgtgctc
gcggggcgggccgtcgtcgtggtcggcgacgagcagcgcgagctcggcgcgggcgagacg
gtgttcatcccgccgttcagcgcgcacgagatccgcaacgggcgcgacgagccgttcgac
atcgtctcgatctactgggagcacatcccgagcgcggtcgaggtgctgggccggcagccg
gccgcggacaaggtcgcggaccgcacgctcgtcgcgtgcccgcccgtcacgccgaacggc
ggcctgcacctggggcatctgtcggggccgtacgtgcgcgccgacatgctggtgcgcgcg
ctgcgcagccagggccgcgaggcgcggcacctgacggggaccgacgaccagcagtcgtac
gtggccgcgcacgcgcgggtcaccggcgcgacgagcacggacgtcgcgctcgcggcgggc
gacgggatcgtcgcgacgctggcggcggcggacgtccgggtggaccgcgtgacgcggccg
ctgcgggacgcgggacacgcggagcggatccgtgagctgttcgcgcgggtcgcggcggcg
ccgaccgtcgaggagcgcgagcgcgagacgccgtactgcccggcgtgcgacctgtcgctg
caccaggcgttcgcgcgcgggacgtgcgcgcactgcgacgcggcgagcgacggggagatc
tgcgaggcgtgcggccggccgaacgaggcgcgcgagctcgtcgacctgcgctgccgtgcg
tgcgacgggccggcggagctgcgcacggagcgcgcgctgtggctcgacctcgccgcgcac
gccgacgagctgcgggcctacctgcgctcggtccacgcgtcgccggacctcatggtgctg
gtcgagcgtctgctcgacgagggcctcgcgccgtaccgcctgacgcgcacgagcgactgg
gggatcacgctcgacgacggtcaggcgatcgacgcgtgggtggacctcgcgctcacgttc
ctcgcggcggtgcaggccgaggccgacgagcacggccccgcccggaccgtgctgttcctc
gggtacgacaacagctactactacgcggtgctgctccccgtcctcgcgatcgcggccggg
ctgaccgagcacctgcccgccacgttcgtcaccaaccagttcctgcacctgggcgctgag
aagttctcgacgagccgcgggcacgccgtgtgggcggacgacgccctgcgcgcctccggt
cccgacgccctgcgcgtcgcgctgctgcgcgacgcgcccgagggccgggtcacccacctc
gacgaggagcgcgcggtcagcctcacgcaggacccgctgcaccgcgccgcgcgcgcgtgg
ctggccgggttcgcgggcatcggcgcggacggcgtggtgcccgggacgggcgcgtggacg
gacgcccaccgcgagttctaccgctacctcggcctggtcacgcagcagctcgacgggctg
ctgctgcccgagtcgttcagcgcgcgcgggtacgtgcggctgctcgacgcgttcgtcgag
cggtgcgcggagttccgggcgacggagacggtggctcgtaccgtgggctcgctcgcggag
gaggcgcgcacgagcctcgcgctggagttcctcgcggccaaggtgttcgccgcgctcgtg
tggccgctcgcgccgcgcaccgcgctggcggtgtggcggtggatcggcctcgagggcgag
ccggtgcgcgagtccgggtggacgttcctgcccggcggcacgcggtgcgacggcccggcg
ccgcgggtcgacgaggccgcgtccgacgaggctgcgtccgacgaggctcctgtggacgcc
gccggcggcgagaccgcacccgacgaggagcgcgagctcgtcgcgagcgggcgcgcgtga

DBGET integrated database retrieval system