KEGG   Canis lupus familiaris (dog): 100682594
Entry
100682594         CDS       T01007                                 

Gene name
PTRH2
Definition
(RefSeq) peptidyl-tRNA hydrolase 2, mitochondrial isoform X2
  KO
K04794  peptidyl-tRNA hydrolase, PTH2 family [EC:3.1.1.29]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cfa03012]
    100682594 (PTRH2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     100682594 (PTRH2)
Translation factors [BR:cfa03012]
 Eukaryotic type
  Release factors
   100682594 (PTRH2)
 Prokaryotic type
   100682594 (PTRH2)
SSDB
Motif
Pfam: PTH2 DUF2076
Other DBs
NCBI-GeneID: 100682594
NCBI-ProteinID: XP_003435333
Ensembl: ENSCAFG00000017662
VGNC: 45202
UniProt: E2RND8
Position
9
AA seq 179 aa
MLSKSLVMEYLAHPGALSLAAGVACGMCLGWGLRVRFGMIPRSSVSETDTETGSEASILG
ESGEYKMILVVRNDLKMGKGKVAAQCSHAAVSAYKQIQRRNPELLKQWEYCGQPKVVVKA
PDEETLVELLTHAKMLGLTVSLIQDAGRTQIAPGSRTVLGIGPGPADLIDKVTGHLKLY
NT seq 540 nt   +upstreamnt  +downstreamnt
atgctctccaaatccttggtgatggaatatttggctcatcctggtgcactcagcttggct
gccggagttgcttgtggcatgtgcctgggctggggcctccgtgtacgctttgggatgatc
cccagaagctcggtcagcgagacagacacagagactggaagtgaagcaagcatcttagga
gagagtggggagtataaaatgattcttgtggttcgaaatgacttaaagatgggaaaaggg
aaagtggctgcccagtgctctcatgctgctgtttctgcctacaagcaaattcaaaggaga
aaccctgagttgctcaaacaatgggaatactgtggccagcccaaagtggtggtcaaagcc
cctgatgaagaaaccttggttgaattattgacccatgcgaaaatgctaggactgactgta
agtttaatccaagatgctggacgtactcagattgcaccaggctctagaactgtcttggga
attgggccaggaccagcagacctaattgacaaagtcactggtcacctaaaactttactag

DBGET integrated database retrieval system