KEGG   Canis familiaris (dog): 100682800Help
Entry
100682800         CDS       T01007                                 

Gene name
TMEM74
Definition
(RefSeq) transmembrane protein 74
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: Neurensin
Motif
Other DBs
NCBI-GeneID: 100682800
NCBI-ProteinID: XP_005627930
Ensembl: ENSCAFG00000000716
VGNC: 47604
UniProt: E2R0P7
Position
13
AA seq 305 aa AA seqDB search
MELHCLAKKSSQAVLCDAADWHSGGLPGDQADAAAVKAALCCQRHCMSTPRAAETEGSKL
RPSPASPSSSLQDSAIQIDSLPPGPLNSGNNQITAGRKVCNCCSQELETSFTCVDENVNL
EQKNRCSLSAKGSSHLGDLGWGNPNEWSHEPAISLISEDEDDVSSEATSSGKSVDYGFVS
AILFLVTGILLVIISYVVPREVTVDPNTVAAREMERLEKESARLGAHLDRCVIAGLCLLT
LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTCTNENTLELSLVEEDA
LDVQS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggagctccactgccttgctaagaagagcagccaggcggtcctgtgtgatgctgcagac
tggcattcaggagggcttcctggtgaccaggcagatgcagcagctgtcaaagctgctctc
tgctgccagagacactgtatgtcgacacccagagcagctgagacagaaggatctaaactt
cgcccttctccagcatccccctcctcctccctgcaagacagtgctattcagatagactct
ttgccgccaggacctctcaactcagggaacaaccaaataacggcaggccggaaagtctgc
aactgctgcagccaggaattagaaacttcttttacctgcgtggatgagaatgtcaactta
gagcaaaagaaccgatgttccctttcagcaaaaggaagcagtcatctgggagaccttggc
tggggaaatccaaatgagtggtcccatgagcctgccatatccttgatatctgaagatgag
gatgatgtaagttcagaagccacatcttcagggaagtccgtagactatggtttcgtcagt
gccatcttgttcttggtcactggcatcttgctggtgatcatctcttacgttgtcccacgg
gaagtgactgtggatcccaacaccgtggcagccagggagatggaacgcttggaaaaggag
agcgcgaggttgggggctcacctggaccgctgtgtgattgcaggactctgcctgcttacg
cttgggggggtcgttctgtcctgtttgctaatgatgtctatgtggaaaggggagctgtat
cgtcgcaacaggtttgcctcttccaaagagtctgcaaaactctacggttctttcaacttc
aggatgaaaacctgcactaatgaaaataccctggaactgtccttggtagaggaagatgct
cttgatgtacagagttaa

DBGET integrated database retrieval system