KEGG   Canis lupus familiaris (dog): 100683495
Entry
100683495         CDS       T01007                                 

Gene name
P4HTM
Definition
(RefSeq) transmembrane prolyl 4-hydroxylase
  KO
K06711  hypoxia-inducible factor prolyl 4-hydroxylase [EC:1.14.11.-]
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:cfa04990]
    100683495 (P4HTM)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     100683495 (P4HTM)
Domain-containing proteins not elsewhere classified [BR:cfa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   100683495 (P4HTM)
SSDB
Motif
Pfam: 2OG-FeII_Oxy_3 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 100683495
NCBI-ProteinID: XP_003432873
Ensembl: ENSCAFG00000012018
VGNC: 44226
UniProt: E2RQG0
Position
20
AA seq 496 aa
MAAAAAAAPRPEAVSPQWAPPGHERTGAAAALGDCEDAPVRPLCKPRGICSRAYFLVLMV
FVHLYLGNVLALLLFVHYSNGDESSDPGPQRRAQGPGPAPTLGPLARLEGIKVGHERKVQ
LVADRDHFIRTLSLKPLLFEIPGFLSDEECRLIIHLAQMKGLQRSQILPTEEYEEAMGTM
QVSQLDLFRLLDQNRDGRLQLREVLAQTRLGNGRWMTPENIQEMYSAIKADPDGDGVLSL
QEFSDMDLRDFHKYMRSHKAASSELVRNSHHTWLYQGEGAHHVMRAIRQRVLRLTRLSPE
IVELSEPLQVVRYGEGGHYHAHVDSGPVYPETICSHTKLVANESVPFETSCRYMTVLFYL
NNVTGGGETVFPVADNRTYDEMSLIQDDVDLRDTRRHCDKGNLRVKPRQGTAVFWYNYLP
DGQGWVGDVDDYSLHGGCLVTRGTKWIANNWINVDPSRARQALFQQEMARLAREGGADSQ
PEWAVDRAYRDARVEL
NT seq 1491 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggccccgaggcccgaggccgtgagtccgcagtgggcgccg
cctggacacgagcggaccggggctgcggccgcgctgggcgactgcgaggacgcacccgtc
cggccgttgtgcaagccccgcggcatctgctcgcgcgcctacttcctggtgctgatggtg
ttcgtgcacctgtacctgggcaacgtgctggcgttgctgctcttcgtgcactacagcaac
ggcgacgagagcagcgaccccgggccccagcgccgcgcccagggccccgggcccgcgcca
accctgggtcccctcgcccggctcgagggcatcaaggtggggcacgagcgtaaggtccag
ctggtcgccgacagggatcacttcatccgaaccctcagcctcaagccgctgctcttcgaa
atccctggcttcctgagtgatgaggaatgtcggctcatcatccacctggcccagatgaag
gggttacagcgcagccagattctgcctactgaagaatacgaggaggcaatgggcacaatg
caggtcagccagctggatctcttccggctgctggaccagaaccgtgatggtcgcctgcag
ctccgtgaggtcctggcccagactcgcctgggaaatggacggtggatgactccagagaac
attcaggagatgtactctgcgatcaaggctgaccctgatggtgatggagtgctgagcctg
caggagttctctgacatggaccttcgagacttccacaagtacatgaggagccacaaggcg
gcctccagcgagctggtgcggaacagccaccatacgtggctctaccagggcgaaggtgcc
caccacgtcatgcgcgccatccgccagagggtgctccgcctcacccgcctgtcacctgaa
atcgtggagctcagtgagccactgcaggttgtgcggtatggcgagggaggccactaccat
gcccatgtggacagcgggcctgtgtacccagagaccatctgctcccataccaagctggta
gccaatgagtctgtacccttcgagacctcctgccgctacatgacagtgctgttttatttg
aacaacgtcaccggtgggggcgagactgtcttccctgtagcagacaacagaacctacgat
gaaatgagtctgattcaggatgatgttgatctccgcgacactcggaggcattgtgacaag
gggaatctgcgtgtcaagccccggcagggcacagcagtcttctggtacaactacctgcct
gatggacaaggttgggtgggcgacgtggatgactactcgctgcacgggggctgcctggtc
acacgcggcactaagtggattgccaacaactggatcaatgtggatcccagccgggctcgg
caggcactgttccagcaggagatggcgcgcttggcccgagaaggtggcgccgactcccag
ccagagtgggccgtggaccgggcctaccgcgacgcgcgcgtggagctctga

DBGET integrated database retrieval system