KEGG   Canis familiaris (dog): 100683724
Entry
100683724         CDS       T01007                                 

Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase-like
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00010  Glycolysis / Gluconeogenesis
cfa01100  Metabolic pathways
cfa01200  Carbon metabolism
cfa01230  Biosynthesis of amino acids
cfa04066  HIF-1 signaling pathway
cfa05010  Alzheimer disease
cfa05132  Salmonella infection
Module
cfa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cfa_M00002  Glycolysis, core module involving three-carbon compounds
cfa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100683724
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100683724
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100683724
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100683724
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    100683724
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    100683724
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     100683724
Membrane trafficking [BR:cfa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100683724
Exosome [BR:cfa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100683724
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N LptD_N
Other DBs
NCBI-GeneID: 100683724
NCBI-ProteinID: XP_003434435
Ensembl: ENSCAFG00000017475
UniProt: L7N0H7
Position
3
AA seq 293 aa
MVYMFQYDSTHGKFHGTVKAENGKLVINGKSISIFQERDPANIKWGDAGAEYVVESTGVF
TTMEKAGAHLKGRAKRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAK
VIHDHFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIP
ELNGKLTGMAFCVPTPNVSVVDLTCRLEKAAKYDDIKKVVKQASEGPLKGILGYTEDQVV
SCDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNWVVDLMVHMASKE
NT seq 882 nt   +upstreamnt  +downstreamnt
atggtgtacatgttccagtatgattctacccacggcaaattccacggcacagtcaaggct
gagaacgggaaacttgtcatcaacgggaagtccatctccatcttccaggagcgagatccc
gccaacatcaaatggggtgatgctggtgctgagtatgttgtggagtccactggggtcttc
accaccatggagaaggctggggctcacttgaaaggcagggccaagagggtcatcatctct
gctccttctgctgatgcccccatgtttgtgatgggcgtgaaccatgagaagtatgacaac
tccctcaagattgtcagcaatgcctcctgcaccaccaactgcttggctcctctagccaaa
gtcatccatgaccactttggcatcgtggagggcctcatgaccaccgtccatgccatcact
gccacccagaagaccgtggacggcccctctgggaagctgtggcgtgacggccgaggggct
gcccagaacatcatccctgcttccactggcgccgccaaggctgtgggcaaggtcatccct
gagctgaacgggaagctcactggcatggccttctgtgtccccacccccaatgtatcagtt
gtggatctgacctgccgcctggagaaagctgccaaatatgatgacatcaagaaggtagtg
aagcaggcatcggagggacccctcaagggcatcctgggctacactgaggaccaggtggtc
tcctgtgacttcaacagtgacacccactcttccacctttgacgccggggctggcattgct
ctcaatgaccactttgtcaagctcatttcctggtatgacaatgaattcggctacagcaac
tgggtggtggacctcatggtccacatggcctccaaggagtaa

DBGET integrated database retrieval system