KEGG   Canis lupus familiaris (dog): 100685718
Entry
100685718         CDS       T01007                                 

Gene name
TMED3
Definition
(RefSeq) transmembrane emp24 domain-containing protein 3
  KO
K20350  p24 family protein gamma-4
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    100685718 (TMED3)
Membrane trafficking [BR:cfa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    100685718 (TMED3)
SSDB
Motif
Pfam: EMP24_GP25L GOLD_2
Other DBs
NCBI-GeneID: 100685718
NCBI-ProteinID: XP_005618488
Ensembl: ENSCAFG00000031547
VGNC: 47438
UniProt: J9P479
Position
3
AA seq 228 aa
MGRGAAPSASASASAFTSASGALLLLLLLLRAGRPRGAELTFELPDSARQCFHEDVDRGV
RFSLDYQVITGGHYDVDCYVEDPLGNTIYRETKKQYDSFTHRAEVKGVYQFCFSNEFSTF
SHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEALKTVIDSQTHYRLREAQDR
ARAEDLNSRVSYWSVGETVALFVVSFSQVLLLKSFFTEKRASPRAVHS
NT seq 687 nt   +upstreamnt  +downstreamnt
atgggccgcggggccgcgccgtccgcctccgcctccgcctccgccttcacctccgcctcg
ggcgcgctgctgctgctgctgctgctgctccgggccgggcggccgcggggcgccgagctg
accttcgagctgcccgacagcgcccgccagtgtttccacgaggacgtggaccggggcgtc
cggttctccctggactaccaggtcatcactggaggccactacgacgtggactgctacgtg
gaggacccgctggggaacacaatctaccgagagaccaagaagcagtatgacagcttcacg
caccgggctgaagtcaagggcgtttatcagttttgcttcagtaacgagttttccactttc
tctcataagaccgtctactttgactttcaagttggtgacgagccccccattctcccagac
atggggaacagggtcacagctctcacgcagatggagtccgcctgtgtgaccatccacgag
gccctgaagaccgtgattgactcccagacacattaccggctccgcgaggcccaggaccgg
gcgcgggcagaagacctcaacagccgggtgtcttattggtctgttggcgagacggttgcc
ctgttcgtggtcagcttcagccaggtgctgctgctgaagagcttcttcacggagaagcga
gccagcccccgggcggtgcactcctag

DBGET integrated database retrieval system