KEGG   Canis familiaris (dog): 100685813Help
Entry
100685813         CDS       T01007                                 

Gene name
MS4A13
Definition
(RefSeq) membrane-spanning 4-domains subfamily A member 13 isoform X1
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: CD20 DUF4064
Motif
Other DBs
NCBI-GeneID: 100685813
NCBI-ProteinID: XP_003432399
Ensembl: ENSCAFG00000028588
VGNC: 43430
Position
18
AA seq 175 aa AA seqDB search
MAPCMCSKISPADSLVLGAVQIMIGIFHVFMWYFLLILYMGQIRGVFGTYEPITYKTGCS
LWGIIFIIAGVSIIRATRHPTQGMITCALTTNIFCIIIAIIASVLTTIELSSFNSVSYRN
YGQAKLGREVSRVLLISYPLEFSIALTYSIFGCIDLNRHNEDTLTAVTEEAESTF
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggctccatgtatgtgttcaaaaatctctccagcagatagtcttgttttaggggctgtc
cagattatgattggcatatttcatgttttcatgtggtatttcttattgattttgtatatg
ggacaaattagaggagtctttgggacgtatgaacctataacttacaaaacaggatgttct
ctatggggcattatttttatcattgcaggagtctccataataagagcaacaaggcatcca
actcaaggaatgattacatgtgctttgaccactaacatcttctgcataattattgcaatt
attgcatcagttctaacaacaattgaattgtcttcttttaattccgtgtcatataggaat
tatggacaagcgaaacttggaagagaagtttcacgggttttactgatatcttaccccttg
gaattttctattgcattaacatactcaatctttggctgtattgatttgaatcgtcataat
gaagatactctcacagctgttacagaggaagctgagagcactttttaa

DBGET integrated database retrieval system