KEGG   Canis familiaris (dog): 100685969Help
Entry
100685969         CDS       T01007                                 

Gene name
COL11A1
Definition
(RefSeq) collagen alpha-1(XI) chain isoform X1
  KO
K19721  collagen, type V/XI/XXIV/XXVII, alpha
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    100685969 (COL11A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:cfa00536]
    100685969 (COL11A1)
Glycosaminoglycan binding proteins [BR:cfa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   100685969 (COL11A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen COLFI Laminin_G_2 Laminin_G_3 Laminin_G_1
Motif
Other DBs
NCBI-GeneID: 100685969
NCBI-ProteinID: XP_005621911
Ensembl: ENSCAFG00000019985
VGNC: 39456
UniProt: J9NYK4
Position
6
AA seq 1806 aa AA seqDB search
MERRPSRWRTRRWPWGLTAAALALTCLLQAAGVGGAAPVDVLKALDFHNSPEGITKTTGF
CTNRKNSKDSDTAYRVSKQAQLSAPTKQLFSGGAFPEDFSILFTIKPKKGIQSFLLSIYN
EHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIV
DCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQLLIIGDPKAAYDYCEHYS
PDCDSSVPKAAQAQEPQIDEYAPEDIMEYDYEYGEAEYKEAEFVTETPTVTEETIAQTEA
NIVDDFQEYNYGTEESYQTVAPRHVSGPNEPNPVEEVFTEEYLTGEDYDSQRKNSEDTLY
ENKGIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPTNEEFGPGVPAETDITETSINSHG
GYGEKGQKGEPAVVEPGMLIEGPPGPAGPAGLMGPPGLQGPTGPPGDPGERGPPGRPGLP
GADGLPGPPGTMLMLPFRYGGDGSKGPTISAQEAQAQAILQQARIALRGPPGPMGLTGRP
GPVGGPGSSGAKGESGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRGMPGEPGAKGDR
GFDGLPGLPGDKGHRGERGPQGPPGPPGEDGMRGEDGEIGPRGLPGEAGPRGLLGPRGTP
GPTGQPGIAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIGPPGEKGPQGKP
GLAGLPGADGPPGHPGKEGQSGEKGALGPPGPQGPIGYPGPRGVKGADGVRGLKGSKGEK
GEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVP
GLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKP
GPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQRGETGFQGKT
GPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGDPGPQGISGKD
GPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTAGPIGLPGRPGPQ
GPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSK
GDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGFPGPPGPIGLQ
GLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGGVGEKGEPGEA
GNPGPPGEAGTGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGPVGFPGDPGPP
GEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGAEGRQGEKGAK
GEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGPPGPMGPPGLP
GLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGIPGPAGPIGPP
GPPGLPGPQGPKGTKGSAGPAGQKGDSGLPGPPGPPGPPGEVIQPLPILSPKKTRRHAEN
MQADAGDNILDYSDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDG
EYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGSWFSEFKRGKL
LSYLDVEGNSINMVQMTFLKLLTASARQNFTYTCHQSAAWYDVSSGSYDKALRFLGSNDE
EMSYDNNPYIKALYDGCASRKGYDKTVIEINTPKIDQVPIVDVMINDFGDQNQKFGFEVG
PVCFLG
NT seq 5421 nt NT seq  +upstreamnt  +downstreamnt
atggagcggaggccgtctcggtggaggacgcggcggtggccctgggggctcaccgcggcc
gccctcgcgctgacttgcctcctccaggctgcaggggtcggcggagcggctccagttgat
gtactaaaagctctagattttcacaactctccagagggaataacaaaaacaacgggcttt
tgcacaaacagaaagaattcaaaagattcggacactgcttacagagtttcaaagcaagca
caactcagtgctcccacaaaacagttattttcaggaggagcttttccagaagatttttca
atactatttacaataaaacccaaaaaaggaattcagtctttccttttatctatatataat
gagcacggtattcagcaaatcggtgttgaggttggaagatcacctgttttcctgtttgaa
gaccacactggaaaacctgccccagaagactatcccctcttcagaactgttaacatcgct
gatggaaagtggcatcgggtagcaatcagcgtggagaagaaaactgtgacaatgattgtg
gattgtaagaagaaaaccacaaaaccacttgatagaagtgagagagcaatcgttgacacc
aatggaatcactgtgtttggaacaagaattttggatgaagaagtttttgagggtgacatc
cagcagctgctgatcataggtgaccccaaagcagcatatgactactgtgagcattatagt
ccagactgtgactcttcagtgcccaaggccgctcaggctcaggaaccgcagattgatgag
tatgcacctgaggatataatggaatatgactatgagtatggggaagcagagtataaggag
gctgaatttgtaacagagacacccactgtaactgaggagacaatagcacaaaccgaggca
aatatcgttgatgattttcaagagtacaactatggaacagaggaaagttatcagacagta
gctcctaggcatgtatctgggccaaatgagccaaatccagttgaagaagtatttactgaa
gaatatctaactggagaggattatgattcccagaggaaaaattctgaggatacactatat
gaaaacaaaggaatagacggcagggactctgaccttctggtagatggagatttaggcgaa
tatgatttttacgaatataaagaatatgaagataaaccaacaagccccactaatgaagaa
tttggtccaggtgttccagcagaaacagatatcacagaaacaagcataaatagccatggt
ggatatggagaaaagggacagaaaggagaaccagcagtagttgaacctggtatgcttatt
gaaggaccaccagggccagcaggacctgcgggtcttatgggtcctcccggtctacaaggc
cccactggaccccctggtgatcctggtgagaggggtcccccaggacgtcctggtttacca
ggcgctgatggtctacccggtcctcccggtaccatgttaatgttgccgtttcgttatgga
ggcgatggttccaaaggaccaaccatctctgctcaggaagctcaagctcaggcgattctt
cagcaggcccggattgctttgagaggtccacctggcccaatgggtctaactggaagaccg
ggtcctgtgggggggcctggttcatctggtgccaaaggtgagagtggtgacccaggtcct
cagggccctcgtggtgttcaaggtccacctggtccaacgggaaaacctggaaaaaggggt
cgtccaggtgctgatggaggaagaggaatgccaggagaacctggagcaaagggagatcgg
ggatttgatggacttccaggtctgccaggtgacaaaggtcacaggggcgaacggggcccc
caaggcccccctggtcctcctggagaagatggaatgaggggagaagatggagaaatagga
ccacggggtcttccaggtgaagctggtccacgaggtttgctgggaccaaggggaactcca
ggacctacagggcagcctggtattgcaggtgttgatggccccccaggaccaaaaggaaac
atgggtccccaaggggagcctggacctccaggtcagcaagggaatccaggacctcagggt
cttcctggtccacaaggtccaatcggtcctcctggcgagaaaggaccacaaggaaaacca
gggcttgcgggacttcctggtgctgatgggcctcctggccatcctggaaaagaaggccag
tctggagaaaaaggtgctctgggtcctcctggtccacagggtcctattggctaccctggt
ccccgaggagtaaagggagcagatggcgtcagaggcctcaagggttctaaaggtgaaaag
ggtgaagatggttttccaggattcaaaggtgatatgggtcttaaaggtgataggggagaa
gttggtcaagtaggtccaagaggagaagatggccctgaaggacccaaaggtcgagcaggt
cctactggagaccctggtccttctggtcaagcaggagaaaaggggaaacttggtgttcca
ggattaccaggatacccaggaagacaaggcccaaagggttccactggatttcctgggttt
ccaggtgccaatggagagaaaggtgcacggggtgtagctggcaaaccaggccctcggggt
cagcgtggtccaacgggtcctcgaggttcaagaggtgcgagaggtccaaccgggaaacct
ggcccaaagggtacttcgggcggtgacggtcctcctggccctcctggagaaagaggccct
caaggacctcagggtccagttggattccctggacccaaaggccctcctggaccccctggg
aaggatggcctgccaggacaccctggacaacgtggagagactggatttcaaggcaagact
ggccccccagggccagggggtgttgttggaccacagggaccaactggggagactggtcca
ataggtgaacgaggacatcctggccctcctggaccacctggtgagcaaggtcttcctggt
gctgcaggaaaagaaggtgcaaagggtgacccaggtcctcaaggtatctcagggaaagac
ggaccagcaggactacgtggtttcccaggtgaaagaggtcttcctggagctcagggtgca
cctggactgaaaggaggagaaggtccccagggcccaccaggtccagttggttcaccagga
gaacgtggatcagcaggtacagctggcccaattggtttgccagggcgtccaggaccccag
ggtcctcctggtccagctggagagaaaggtgctcctggagaaaaaggtccccaaggtccc
gcagggagagatggagtccaaggtcctgtgggtctcccagggcctgctgggcctgcgggc
tcccctggagaagatggagacaagggtgaaatcggtgaacccggacagaagggcagcaag
ggtgacaaaggagaaaatggtcctcctggtcccccaggtcttcagggtcctgttggcgcc
cctggaattgctggaggtgatggcgagccaggtcccagaggtcagcagggcatgtttgga
caaaaaggtgatgagggtgccagaggtttcccaggacctcctggtcccataggtcttcag
ggactgccaggcccgcctggtgaaaaaggtgaaaatggggatgttggtcccatgggtcca
cctggtcctccaggcccaagaggtcctcaaggtcccaatggagctgatggaccacaagga
cccccaggatccattggttcagtcggtggtgttggagaaaagggtgaacctggagaagca
gggaacccggggcctcctggggaagcaggcacaggcggccccaaaggggaaagaggagag
aaaggagaggctggcccgcctggtgctgctggacctcctggtgccaagggaccaccaggt
gacgatggccctaagggtaacccgggtcctgttggttttcctggtgatcccggtcctcct
ggagaacctggccctgcaggtcaagatggtgttggtggtgacaagggtgaagatggagat
cctggtcaaccgggtcctcctggcccatctggtgaggctggcccaccaggtcctcctgga
aaaaggggtcctcctggagctgcaggtgcagagggaagacaaggtgaaaaaggtgctaag
ggagaagcaggtgccgagggtcctcctggaaaaactggtccagtcggtccccagggacct
gccggaaagcctgggccagagggtcttcggggcatccctggcccagtgggagaacaaggt
ctccctggagccgcaggccaggatgggcctcctggtcctatgggacctcctggcttacct
ggtctcaaaggtgaccccggctccaagggtgagaagggacatcctggtttaattggcctg
attggacctccgggagaacaaggtgaaaaaggtgacagaggactccctggaactcaggga
tctccaggagcaaagggggatggaggaattccaggtcctgctggtcccataggtccacct
ggtcctccaggcttaccaggtcctcaaggtccaaagggaaccaaaggctctgctggacct
gccggccagaagggtgacagtggtcttccagggcctccaggacctccgggtccacctggg
gaagtcattcagcctttaccaatcttgtcacccaagaaaacaagaagacatgctgaaaac
atgcaagcagatgcaggggataatattcttgattactcggatggaatggaggaaatattt
ggttctctcaattccctgaaacaagacatcgagcatatgaagtttccaatgggtactcag
actaacccagcccgaacttgcaaagacctgcaactcagccatcctgacttcccagatggt
gaatattggattgacccaaaccaaggttgctcaggagattccttcaaagtttactgtaat
ttcacatctggtggtgagacttgcatttatccagacaaaaaatctgaaggagtgagaata
tcatcttggccaaaggagaaaccaggaagctggtttagtgaatttaagagaggaaaactg
ctttcctatttagatgttgaaggaaattccattaatatggtgcaaatgacattcctgaaa
ctgctgactgcctctgctcggcagaatttcacctacacctgtcatcaatcagcagcctgg
tatgatgtgtcatcaggaagttacgacaaagcacttcgattcctgggatcaaatgatgag
gagatgtcctacgacaacaacccttacatcaaagcactgtatgatggctgtgcgtccaga
aaaggctatgacaaaactgtgattgaaatcaatacaccgaaaattgatcaagtacctatc
gttgatgtaatgatcaatgactttggtgatcagaatcagaagtttggatttgaagttggt
cctgtttgtttccttggctaa

DBGET integrated database retrieval system