KEGG   Canis familiaris (dog): 100686076
Entry
100686076         CDS       T01007                                 

Gene name
SEC22A
Definition
(RefSeq) vesicle-trafficking protein SEC22a isoform X2
  KO
K08520  SEC22 vesicle trafficking protein A/C
Organism
cfa  Canis familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    100686076 (SEC22A)
Membrane trafficking [BR:cfa04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Putative SNAREs
    100686076 (SEC22A)
SSDB
Motif
Pfam: Longin
Other DBs
NCBI-GeneID: 100686076
NCBI-ProteinID: XP_005639629
Ensembl: ENSCAFG00000012072
VGNC: 45967
UniProt: E2RSR7
Position
33
AA seq 318 aa
MPANRSSLLVEMSMILSASVIRVRDGLPLSASTDYEQGTGVQECRKYFKMLSKKLAQLPD
RCTLKTGHYNINFISSLGVSYMMLCTENYPNVLAFSFLDELQKEFITTYNMMKTNTAVRP
YCFIEFDNFIQRTKQRYNNPRSLSTKINLSDMQMEIKLRPPYQISMCELGSANGVTSAFS
IDYKGAGKISSAHLRLEPATLSGIVAFILSLLCGALNLIRGFHAIESVLQSDGEDFNYVV
AFFLGTAACLYQCYLLVYYTSWRNVKSFLTFGLICLCNMYLYELRNLWQLFFHVTVGAFV
TLQIWLRQAQGKAPDYDV
NT seq 957 nt   +upstreamnt  +downstreamnt
atgccagctaacaggtcttctctgctggttgaaatgtctatgattttatctgcatcagtc
attcgcgtcagagatggactccccctttctgcttctactgactatgaacaaggcacaggc
gtgcaggagtgcagaaagtattttaaaatgctctcaaagaaacttgctcagcttcctgat
agatgtacactgaaaactggacattataacattaattttattagctctctgggagtgagc
tacatgatgttgtgcactgaaaattacccaaatgttctggccttctctttcctggatgag
cttcagaaggagttcattactacttacaacatgatgaagacaaatactgctgtcagacca
tactgtttcattgaatttgataacttcattcagaggacaaagcagcgatataataatccc
aggtctctttcaacaaagataaatctgtctgacatgcagatggaaatcaagctgaggccc
ccttatcaaatttccatgtgtgaactggggtctgccaatggagtcacatctgcattttct
attgactataaaggtgctggtaagatttcttctgctcacctgcgactggaaccagcaact
ctgtcagggattgtggcttttatcctcagtcttttatgtggagctctgaatttaattcga
ggttttcatgccatagaaagtgttttgcagagtgatggtgaagattttaattacgttgtt
gcatttttccttggaacagcagcctgcctttaccagtgttatttacttgtctactacacc
agctggcggaatgtcaaatcttttttgacttttggtttaatctgtctatgcaacatgtat
ctctatgaactgcgcaacctgtggcagcttttctttcacgtgactgtgggagcgtttgtt
acgctacagatctggctaaggcaggcccagggcaaggctcctgattatgatgtctga

DBGET integrated database retrieval system