KEGG   Canis familiaris (dog): 100686499Help
Entry
100686499         CDS       T01007                                 

Gene name
GLS2
Definition
(RefSeq) glutaminase liver isoform, mitochondrial isoform X2
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00220  Arginine biosynthesis
cfa00250  Alanine, aspartate and glutamate metabolism
cfa00471  D-Glutamine and D-glutamate metabolism
cfa01100  Metabolic pathways
cfa04724  Glutamatergic synapse
cfa04727  GABAergic synapse
cfa04964  Proximal tubule bicarbonate reclamation
cfa05206  MicroRNAs in cancer
cfa05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100686499 (GLS2)
   00220 Arginine biosynthesis
    100686499 (GLS2)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    100686499 (GLS2)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100686499 (GLS2)
  Nervous system
   04724 Glutamatergic synapse
    100686499 (GLS2)
   04727 GABAergic synapse
    100686499 (GLS2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100686499 (GLS2)
   05206 MicroRNAs in cancer
    100686499 (GLS2)
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     100686499 (GLS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_5 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 100686499
NCBI-ProteinID: XP_003431516
Ensembl: ENSCAFG00000000131
VGNC: 41277
UniProt: E2QV76
Position
10
AA seq 602 aa AA seqDB search
MRSLRALQEALSGAGAQCRLGGWGRPSRSPLLGGGVRHHLSEAAALGRETPHSHQPQRQD
HDSSESGMLSRLGDLLFYTIAEGQERIPIHKFTTALKATGLQTSDPRLRDCMSQMRRMVR
ESSSGGLLDRDLFQKCVSSNIVLLTQAFRKKFVIPDFEEFTSHVDRIFEDAKELTGGKVA
AYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISISTLGTEYVHK
FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDFVLQYLNKMAG
NEYIGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLCSVEVTCESG
SVMAATLANGGICPITGESVLSAEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSAVSGA
ILLVVPNVMGMMCLSPPLDKLGNSHRGISFCQKLVSLFNFHNYDNLRHCARKLDPRREGG
EVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGHIEVVKFLIE
ACKVNPFVKDRWGNVPLDDAVQFNHLEVVKLLQDYQDSYTPSETQAEAAAEALSKENLES
MV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccctcagggctctgcaggaggcgctgagcggggccggcgctcagtgccggctg
ggaggctggggccgcccgagccggagccctctccttggcgggggcgtccggcaccacctc
agtgaggccgcggcgctgggcagggagacgccgcacagccaccagccgcagcgccaggat
catgattcatcagagagtggcatgctatcccgcctgggtgatctcctcttctacactatt
gctgaaggacaggaacgaatccccatccacaagttcactactgcactgaaggccactgga
ctgcagacatcagatccccggctccgggactgcatgagccagatgcgccgcatggttcga
gagtccagcagtggtggcctcttggaccgagatctcttccaaaagtgtgtgagcagcaac
attgtgctcctgacccaggcattccgaaagaagtttgtcattcctgattttgaggagttc
acgagccatgtggatcgcatctttgaggatgccaaagagctcactggaggcaaagtggcg
gcttatatccctcagctggccaagtccaatccagacctgtggggcgtctccttgtgcact
gtggatggtcaacggcactccgtgggccacacaaagattcccttctgcctgcagtcctgt
gtgaagcccctcacctatgctatctccataagcaccctagggactgagtacgtgcacaag
tttgtgggcaaggagcccagtggcctacgctacaacaagctgtccctcaatgaggaagga
atcccccataaccccatggtcaatgctggtgccattgtcgtgagctccctgatcaagatg
gactgtaacaaagcagagaagtttgattttgtgttacagtatctgaacaaaatggctggg
aacgaatacataggtttcagcaatgccacattccagtcagagaaggaaacaggggatcgg
aattatgccatcggctattatctaaaggaaaagaagtgctttcctaagggggtggacatg
atggctgctcttgatctctatttccagctgtgctctgtggaggtgacctgtgagtcgggc
agcgtcatggcagccaccctggccaacggcgggatctgccccatcacgggggagagcgtc
ctgagtgctgaagcagtgcgcaacaccctcagcctcatgcactcctgtggcatgtatgac
ttctcgggccagtttgccttccacgtgggcctgccggccaagtcagctgtgtcaggagcc
atcctcctagtggtacccaatgtcatgggaatgatgtgtctgtcacctccactggacaag
ctagggaacagccataggggcatcagcttctgccagaagctggtatctcttttcaatttc
cacaactacgacaacctgaggcactgtgctcggaagttagacccacggcgtgaaggggga
gaagttcggaacaagactgtggtgaacctgttatttgctgcctatagtggagatgtctca
gctcttcgaaggtttgccttgtcagccatggacatggaacagaaagactatgattcccgc
acagccctgcatgttgctgcggctgaaggacacattgaagttgttaaattcctgattgaa
gcttgcaaagtgaatccttttgtcaaggacaggtggggcaacgttcccttggatgatgct
gtgcagttcaaccacctggaggttgtgaaactgctgcaggattaccaggactcctacaca
ccatctgagactcaggccgaggcagcggctgaggccctgtccaaagaaaacttagagagc
atggtgtga

DBGET integrated database retrieval system