KEGG   Canis familiaris (dog): 100686778Help
Entry
100686778         CDS       T01007                                 

Gene name
CYP1A1
Definition
(RefSeq) cytochrome P450 1A1
  KO
K07408  cytochrome P450 family 1 subfamily A polypeptide 1 [EC:1.14.14.1]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa00140  Steroid hormone biosynthesis
cfa00380  Tryptophan metabolism
cfa00830  Retinol metabolism
cfa00980  Metabolism of xenobiotics by cytochrome P450
cfa01100  Metabolic pathways
cfa04913  Ovarian steroidogenesis
cfa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100686778 (CYP1A1)
  Amino acid metabolism
   00380 Tryptophan metabolism
    100686778 (CYP1A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100686778 (CYP1A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100686778 (CYP1A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    100686778 (CYP1A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100686778 (CYP1A1)
Enzymes [BR:cfa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100686778 (CYP1A1)
Cytochrome P450 [BR:cfa00199]
 Cytochrome P450, animal type
  CYP1 family
   100686778 (CYP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450 Gemini_BL1
Motif
Other DBs
NCBI-GeneID: 100686778
NCBI-ProteinID: XP_003433938
Ensembl: ENSCAFG00000017937
VGNC: 50332
UniProt: F1P8R7
Position
30
AA seq 524 aa AA seqDB search
MMSMFRLSIPISASELLLASTVFCLVLWVVKAWQPRLPKGLKSPPGPWGWPLLGNVLTLG
KSPHLALSRLSQRYGDVLQIRIGSTPVLVLSGLDTIRQALVRQGDDFKGRPDLYSFSLVT
DGQSLTFSPDSGPVWAARRRLAQNALKSFSIASDPASSCSCYLEEHVSKEAEVLLSRLQE
QMAEVGRFDPYRYIVVSVANVICAMCFSKRYDHDDQELLSLVNLSNEFGEGVASANPLDF
FPILRYLPNPALDFFKDLNKRFYSFMQKMVKEHYKTFEKGQIRDVTDSLIEHCQDKRLDE
NANIQLSDEKIVNVVLDLFGAGFDTVTTAISWSLLYLVTNPNVQKKIQKELDTVIGRARQ
PRLSDRPQLPYMEAFILETFRHASFVPFTIPHSTTRDTSLSGFYIPKGRCVFVNQWQINH
DQKLWGNPSEFQPERFLTLDGTINKALSEKVILFGLGKRKCIGETIARLEVFLFLAILLQ
QVEFSVPEGTKVDMTPIYGLTMKHARCEHFQVRVRTEGAESSAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatgttcagactctccatccccatctcggcctcagagcttctcctggcctcc
accgtcttctgcttggtactctgggtggtcaaggcctggcagcctcggcttcccaaaggc
ctgaagagtccaccggggccctggggctggcccctgctcgggaacgtgctgaccttgggc
aagagcccccacctggcgctgtccaggctgagccagcgttatggggacgtgctgcagatc
cgcatcggctccacccccgtgctggtgctcagtggcctggacaccatccggcaggccctg
gtgcgccagggggatgatttcaagggccggcccgacctctacagcttctctctggttacc
gacggccaaagcctgaccttcagcccagactccggaccagtgtgggctgcgcgcaggcgc
ctggcccagaacgcgctgaagagtttctccattgcctccgacccggcttcctcgtgctct
tgctacctggaagagcatgtgagcaaggaggccgaggtccttctcagcaggctgcaggag
cagatggcagaggttgggcgctttgatccctatagatacatagtggtgtcggtggccaac
gtcatctgtgccatgtgctttagcaagcgctatgaccatgacgaccaggagctgcttagc
ttagtcaacctgagtaatgagtttggagagggggttgcctctgcgaaccccttggacttc
tttcccatccttcgatacctacccaaccctgccctggatttcttcaaggacctgaataag
agattctacagcttcatgcaaaagatggtcaaggaacactataaaacgtttgagaagggc
caaattcgggatgtcacagacagcctgatcgagcactgtcaggataagaggctggatgag
aatgccaatatccagctgtctgatgagaagattgttaatgttgtcttggacctctttgga
gctggatttgacacagtcacaactgccatctcctggagcctcctgtacttggtgacaaac
cccaatgtacagaaaaagatccagaaggagctggacacagtgattggcagggcacggcaa
ccccggctctctgacaggccccagctgccctacatggaggcattcatcctggagaccttc
cgacatgcttccttcgtccccttcaccatccctcatagcaccacaagagacacgagtctg
agtggcttttacatccccaagggacgttgcgtctttgtgaaccagtggcagatcaaccat
gaccagaagctatggggtaacccgtctgagttccaaccagaacgattcctcactctcgat
ggcaccatcaacaaggcactgagtgagaaggtgattctctttggtttgggcaagcggaag
tgcatcggtgagaccatcgctcgcttggaggtctttctctttctggccatcctgctgcag
caggtggaatttagtgtgccagagggcacaaaggtagatatgacccccatttatgggctg
accatgaagcacgcccgctgtgaacacttccaagtgagggtgcgcactgagggggctgag
agctctgcagcctag

DBGET integrated database retrieval system