KEGG   Canis familiaris (dog): 100686895Help
Entry
100686895         CDS       T01007                                 

Gene name
C30H15orf59
Definition
(RefSeq) UPF0583 protein C15orf59 homolog
Organism
cfa  Canis familiaris (dog)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4589 bZIP_1 IFT57 Trns_repr_metal
Motif
Other DBs
NCBI-GeneID: 100686895
NCBI-ProteinID: XP_003433987
Ensembl: ENSCAFG00000030990
VGNC: 52551
UniProt: J9P958
Position
30
AA seq 287 aa AA seqDB search
MNIRGTPDLGQPSDDPSSGGQRERIRQRMKMVIGQLEGILQELKEVAKELREVVSQIDKL
TSDFDFELEPDDWTTATVSSTSSSDKAGVGGPFDLGHLDLVTADILSDSWEFCSFLDAST
PSDSVDGAEPSRPGAGPDYRLMNGGTPVPNGPRVETPDSSSEEAFGGGPAKGQPQRTPGT
RERVRFSDKVLYHALCCDDEEADGGAAAEAGLSPEPPRPEAPVGAPKPPPAPCKPRRPPL
TSCRPGPAAPEQTRRVTRNSSTQTVSDKSTQTLLPYTAAKQKAKGKN
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcggggcaccccggacctcgggcagcccagtgacgaccccagcagtggtggc
cagcgggagcggattcgacagcgcatgaagatggtcatcgggcagctcgagggcattctg
caggaactcaaggaggtggccaaggagctcagggaggtggtgagccagatcgataagcta
acctcagacttcgacttcgaactggagccagacgactggaccacagccactgtgagcagc
acctccagcagcgacaaggcgggcgtgggcggccccttcgacctgggccacctggacctc
gtcacggccgacatcctctcggacagctgggagttctgctccttcctggacgcgtccacc
ccgtcggactctgtggacggcgccgagccctcgcggccgggggctggccccgactaccgg
ctcatgaacggcggcacgcccgtccccaacgggccccgggtggagaccccggactcctcc
agcgaggaggccttcggcggcggcccggccaagggccagccccagcggaccccaggcacc
cgcgagagggtgcgcttcagcgacaaagtgctctaccacgccctgtgctgcgacgacgag
gaggcggacggcggggcggcggccgaggcgggcctgtccccagagcccccccgccccgag
gccccggtgggcgcccccaagcccccgcccgccccctgcaagcccaggcgccctccgctg
accagctgccgcccgggccccgccgcccccgagcagacccggagggtcacaaggaacagt
agcacccagacggtgtccgacaaaagcactcagacgttgctgccctacacggctgccaaa
cagaaggccaaggggaaaaactag

DBGET integrated database retrieval system