KEGG   Canis lupus familiaris (dog): 100688833
Entry
100688833         CDS       T01007                                 

Gene name
ATMIN
Definition
(RefSeq) ATM interactor isoform X1
Organism
cfa  Canis lupus familiaris (dog)
SSDB
Other DBs
NCBI-GeneID: 100688833
NCBI-ProteinID: XP_003639116
Ensembl: ENSCAFG00000020016
VGNC: 53265
Position
5
AA seq 832 aa
MAASEAAAAGSAALASGAPTVPTAARGAAAAAAAAAAAAAAASGPWGPPGRLRGSRPRPA
AARQQPAGPAPPARELIQPSVSELSRAVRTNILCTVRGCGKILPNSPALNMHLVKSHRLQ
DGIVNPTIRKDLKTVPKFYCCPIEGCPRGPDRPFSQFSLVKQHFMKMHAEKKHKCSKCSN
SYGTEWDLKRHAEDCGKTFQCTCGCPYASRTALQSHIYRTGHEIPAEHRDPPSKKRKMES
CLHSQKLSSKTTESLSTQPATKPDTQELETSEIKLVASFEDSCSSNAGKQTLTPPPRYPQ
KLLLPKPKVALVKLPVMQFSPVPVFVPTADSSAQPVVLGVDHQGSAPGAVHILPLSVGTL
ILGLDSEAACLKESLPLSKIVSPVAMEPISTGVQVNLGKSLSDPSQELGNTCQKNSISSI
NVQTDLSYATPHFIPSTQWAGPDSSVSSCSQTDLTFGSQVSLPISVHTQTFLPSSKVTSS
IAAQTDTFIDACYQSGGISRETQTSGMHNLTDDRVQMDQAVMGGDIFESVHPSYGVSTDS
IISSSLVAETVTHDLLPQNHPKTLNQDLEKSAPIINFSAQHSMLPSQNMTDNQTQTIDLL
SDLENILSSNLPSQTLDNRSLLSDTSTGPDPQLPSGPTQNPAIDFDIEEFLSASNIQTQT
EESELNTMTTEPVLESLDIETQTDFFLADTSAQSYSCRGNSNFLGLEMFDTQTQTDLNFF
LDSSPHLPLGSILKHSSFSMSTDSSDTETQTEGISAAKNIPTIESKVQLNSTETQTMNSG
FETLGSLFFTSNETQTAMDDFLLADLAWNTMESQFSSVETQTCAELHTVSNF
NT seq 2499 nt   +upstreamnt  +downstreamnt
atggcggcctctgaggcggcggcggcggggtccgcggctctggcctcgggcgccccgacc
gtcccgacggccgcgaggggagccgccgccgccgccgccgccgccgccgccgccgccgcc
gccgcctcgggcccgtgggggccccccggacggctaagaggcagccggccgcggcccgcg
gcggcgaggcagcagcccgcgggtccggcgcctccggcccgggagctgatccagccgtcg
gtgagcgagctgtcccgggccgtgcggaccaacatcctgtgcacggtgcgcggctgcggc
aagatcctgcccaacagcccggcgctcaacatgcacctggtcaagagccaccgcctgcag
gatggcatagtaaatccaacaataagaaaagacttgaaaaccgtaccgaaattctactgt
tgtccaattgaaggatgccctagaggccctgacagaccattttctcaattttctctcgta
aaacagcactttatgaaaatgcatgctgaaaagaagcataaatgcagtaagtgcagcaat
tcctacggcacggagtgggacttgaaaaggcatgcagaggattgtggcaagaccttccag
tgcacgtgtggctgtccctatgccagtagaactgctttacagtcccacatctaccgcact
ggccatgagatcccagcagagcacagggatccacctagtaaaaaaaggaaaatggagagc
tgcctgcacagccaaaagttgtccagtaagaccactgagtccctgagtacccaaccagct
acaaaaccagacactcaggaactggaaacttcagaaataaagctggtcgcgtcttttgaa
gactcttgcagctctaatgccggaaagcagactcttacaccacctccaagataccctcag
aagttgcttttacccaagcccaaggtggctctggtgaaacttcctgttatgcagttttct
cccgtgcctgtcttcgtgcctacagccgactcctcagctcagcctgtggtgttgggtgtt
gatcatcaaggttctgccccaggcgctgtgcacatactgcccttgtcagtaggaaccctc
atccttggcctagattcagaggctgcctgtcttaaagagagtctccctctttcaaaaatt
gtaagtcctgtggccatggagccaattagtacaggtgttcaagtgaacttgggtaagagc
ctgtctgatccttcacaagaactagggaacacctgtcagaagaacagcatatcttccatc
aacgtacagacggacctgtcttacgccacaccgcacttcataccttccacacagtgggct
ggccctgattcctctgtatcttcttgttctcaaacagatttgacatttggttctcaagtc
tcccttcccattagcgttcatacgcaaacgtttttgcccagttctaaggtgacctcatcc
atagctgctcagactgatacatttatagatgcctgttaccagtcaggtgggatctccaga
gaaacccagaccagtggaatgcataatctgacagatgacagagtacagatggaccaagct
gtaatgggtggagacatttttgagagcgtccatccatcctatggtgtttctacagacagt
attataagcagcagcttagtagcagagactgtcactcatgatttgttacctcagaaccac
cctaagactttaaatcaagatcttgagaaatctgcaccaattataaacttcagtgcacag
cacagtatgcttccttcacagaacatgacagataatcagacccaaactatagatttatta
agtgatttggaaaacatcttgtcaagtaatctgcccagtcagacactggacaatcgtagt
cttttgtctgacacgagtactggacctgacccccagcttccatctggcccgacccagaat
cccgcaatcgattttgatattgaagagttcttgtcggcctcaaatatccagactcaaacc
gaagagagtgagcttaacaccatgaccactgagcctgtcttggaatcgctggacatagaa
acccaaacagacttcttccttgcagacacctctgctcagtcctatagttgtaggggaaat
tctaactttttaggccttgaaatgtttgacacacagacacagacagacttaaacttcttt
ttagacagtagcccccatctgcctctgggaagtattctgaaacactccagcttttccatg
agtactgattcatctgacacagagacccaaactgaaggaatctccgctgctaaaaatata
cctactatagagagcaaagttcagttgaacagtacagaaacacaaaccatgaattccggc
ttcgaaaccctggggagcttgttcttcaccagcaacgaaactcaaacagcaatggacgac
tttcttctggccgatttggcctggaacacaatggaatctcagtttagctctgtagaaacc
cagacatgtgcggaactacacacagtctccaacttctga

DBGET integrated database retrieval system