KEGG   Canis lupus familiaris (dog): 100855495
Entry
100855495         CDS       T01007                                 

Gene name
CTR9
Definition
(RefSeq) RNA polymerase-associated protein CTR9 homolog
  KO
K15176  RNA polymerase-associated protein CTR9
Organism
cfa  Canis lupus familiaris (dog)
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:cfa03021]
    100855495 (CTR9)
Transcription machinery [BR:cfa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    PAF1 complex
     100855495 (CTR9)
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_19 TPR_8 TPR_16 TPR_14 TPR_12 TPR_17 TPR_10 TPR_11 TPR_6 TPR_7 ANAPC3 PknG_TPR
Other DBs
NCBI-GeneID: 100855495
NCBI-ProteinID: XP_003639833
Ensembl: ENSCAFG00000007638
VGNC: 39706
UniProt: E2R0D1
Position
21
AA seq 1173 aa
MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEF
VKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMA
DKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYR
GALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAV
LELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTE
VEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENA
SQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQ
ILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR
AKAEAEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAM
ARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSD
TYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHK
GYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVV
LYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVL
NAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERE
LRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKNILMFTGETEATKE
KKRGGGGGRRSKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEEEEGGERKKKKR
RRPPKGEEGSDDDETENGPKPKKRRTPRAEKKKAPKPERLPPSMKGKIKSKAIISSSDDS
SDEDKLKIADEGHHRNSNSNSDSDEGERRKKHASSESDSDENQNKSGSEAGSPRRPRRQE
SDEDSDSDQPSRKRRPSGSEQSDNESVQSGRSRSGGSDMDSRPASPSAESEHDSERGSDN
EGSGQGSGNESEPEGSNNEASDRGSERGSDESD
NT seq 3522 nt   +upstreamnt  +downstreamnt
atgtcgcggggctccatcgagattcccctccgggacactgacgaggtcattgaacttgac
ttcgatcagttaccggagggagatgaagttatcagtattctgaaacaggaacacacacaa
ctgcacatatggattgctttggcgctggagtattacaagcaaggaaaaacggaagagttt
gtaaagttgttggaagcagcacgtatagatggcaatttggactatagagaccatgaaaaa
gaccagatgacttgcttggatacattggcagcctattatgtacaacaggctcggaaggaa
aagaataaagacaataagaaagatcttattacacaagcaaccctgttgtataccatggct
gacaaaattattatgtacgaccagaaccatttgttgggaagagcctgcttctgcctactt
gaaggtgacaaaatggatcaggctgatgcacaatttcattttgtactcaaccagtctcca
aataatattccagcccttcttggtaaagcttgcatttcattcaacaagaaggattacaga
ggagctcttgcttactataagaaagcattgcgtactaacccaggatgtccagcggaagtt
cgtttaggaatgggtcattgctttgtgaaactcaacaaactggagaaggctcgtctggca
ttcagcagagccctggaactcaattccaaatgtgtgggagcattggttggactggctgta
ctggaactcaacaataaagaggctgattccatcaaaaatggtgttcagcttctttccaga
gcctatactattgatcctagcaaccccatggtattgaaccacttagcaaatcactttttc
ttcaaaaaggattatagtaaagtccagcacttggctctccatgcattccataatacagaa
gtggaggctatgcaagcagaaagttgctatcagctggctagatcattccacgttcaggaa
gattatgaccaagctttccagtactactatcaagccacacagtttgcctcatcctctttt
gtgctgccattttttggtttgggacaaatgtacatttatcgaggtgacaaagaaaatgca
tctcagtgctttgagaaagttttgaaagcttatcctaataattatgaaactatgaaaatt
cttggatcgctatatgctgcctcagaagatcaagaaaaaagagatattgccaagggccat
ttgaagaaggtcacagaacagtatcctgatgacgttgaagcttggattgaattggcacaa
atcttagaacagactgatatacagggtgccctctcagcctatggaacagctacacgtatc
cttcaggagaaagtgcaggccgatgtcccgccagagattctgaataatgtgggcgccctc
cattttagacttggaaatctaggggaggcaaagaaatattttttggcatcattggatcgt
gcaaaggcagaagctgagcatgatgaacactattataatgccatttctgttacgacatca
tacaatttagccaggctgtatgaggcaatgtgtgaattccatgaagcagaaaaactctat
aaaaacatcttacgggaacatcctaattatgttgactgctatctgcgcctgggagctatg
gctagagataaaggaaatttttatgaggcttcagattggtttaaggaagctcttcagatc
aatcaggaccatccagacgcttggtctttgattggtaaccttcatttagcaaaacaagaa
tggggtccaggacagaagaaatttgagaggatattaaaacaaccatctacgcagagtgat
acttactctatgctagctcttggcaacgtctggctccaaactttgcatcagcccacccga
gatcgagaaaaggaaaaacgtcatcaagaccgtgctctggccatctataaacaagtactc
cgaaatgatgcaaagaatctgtatgctgctaatggcataggagctgttttggcccacaaa
ggatattttcgtgaagctcgtgatgtatttgcccaagtaagagaagcaacagcagatatc
agtgatgtgtggttaaacctagcacacatctacgtggaacagaagcaatatattagtgcc
gttcagatgtatgaaaactgcctcagaaagttctataagcatcagaacacggaagttgtg
ctatatttggcccgggccctcttcaagtgtggcaagttacaggaatgcaaacagactttg
ctaaaggctagacatgtggcacccagtgatacagtacttatgtttaatgtggccttggtc
ctgcaaagattagctacctctgttctaaaggatgaaaagagtaatctgaaggaagtactt
aatgctgtgaaagaactggagcttgcacatagatatttcagttacttgagtaaagtggga
gataaaatgagattcgatttggcccttgctgctacagaagccaggcagtgctctgacttg
ttgagccaggcccagtaccatgtggctcgggcacgtaaacaagatgaagaagaaagggag
ttacgggccaaacaagagcaagaaaaggaactgttaaggcagaaacttcttaaagaacag
gaagagaaacgtctcagagaaaaggaagagcaaaagaaacttttggaacagcgggcccag
tatgtagagaagaccaaaaacattcttatgtttactggagagactgaagcaacaaaagaa
aagaaaagaggtggtggtggtggacggcgttctaaaaagggaggagagtttgacgaattt
gtcaatgatgatacggacgatgacctgcctatatccaaaaagaagaagagaagaaagggc
agtggtagtgaacaagaaggcgaagaagaggagggtggtgagagaaagaagaaaaagagg
agaagacctccaaagggagaagaaggatctgatgatgatgaaacagaaaatggcccaaaa
ccgaaaaagcgccgtaccccgagagcggagaagaagaaggctcccaagccagaacgtctg
cctccttcaatgaagggcaaaataaaatcgaaagccataatatcatcaagtgatgattct
tcagacgaagataaacttaaaattgccgatgaaggacatcaccgcaacagcaacagcaac
agtgactcggacgagggagagcggcggaagaaacacgcctcttcggagagcgattctgat
gagaaccaaaataagtctggcagcgaggccggcagtccccggaggccccgcagacaggag
tcagatgaggattcagacagtgaccagccatccagaaagagaaggccctcaggttctgaa
cagtctgacaatgagtctgtgcagtccgggagaagccgctctggaggttccgacatggac
tctcgccctgcttctccgagtgccgagtcagagcacgattccgagagaggctctgataac
gagggctctggccaaggctctgggaatgaatccgaaccagagggatccaacaatgaggcc
tcggatcggggctcagaacgtgggtcagatgagagcgactag

DBGET integrated database retrieval system