KEGG   Canis familiaris (dog): 100855508
Entry
100855508         CDS       T01007                                 

Gene name
NR0B1
Definition
(RefSeq) nuclear receptor subfamily 0 group B member 1 isoform X1
  KO
K08562  nuclear receptor subfamily 0 group B member 1
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04927  Cortisol synthesis and secretion
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    100855508 (NR0B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cfa03000]
    100855508 (NR0B1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:cfa03310]
    100855508 (NR0B1)
Transcription factors [BR:cfa03000]
 Eukaryotic type
  Zinc finger
   Cys4 Knirps/DAX 1-like
    100855508 (NR0B1)
Nuclear receptors [BR:cfa03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   100855508 (NR0B1)
SSDB
Motif
Pfam: NR_Repeat Hormone_recep HxlR
Other DBs
NCBI-GeneID: 100855508
NCBI-ProteinID: XP_003640302
Ensembl: ENSCAFG00000013658
VGNC: 43938
UniProt: E2R3L9
Position
X
AA seq 471 aa
MAGEDHQWQGSILYNMLMSAKQTHAAPVAPEARLGGACWGCSCGAEPAPGRGALPGARTT
ALLYRCCFCGEEHPRQGSILYNMLTSAKQTRAAAEAPEARLGGACWGCSCGAEPAAGRGA
LPEARTTVLLYRCCFCGEEHPRQGSILYSLLTSAKQTHVAPETPEVRPGGAWWGRSYSAQ
GPGGREQLPGRQAVAYLSRCCFCGDEHPRPGSIFHRLPASAKQTHAAREMQPAAPWWDPR
CDAQRRVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNSWAPLLLLEL
AQDRLNFETVETSEPSLLQRILTTRRRETAGDEPPPPTPQPPPLVPPREAGRLPTAAEVQ
AIKCFLAKCWSLDISTKEYAYLKGTVLFNPDLPGLHCVKYIQGLQWGAQQILSDHIRMTH
RGYQARFTELNSALFLLRYVNADVIVELFFRPIIGSVSMDDMMLEMLCAKL
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggcaggcgaggaccaccagtggcagggcagcatcctctacaacatgctcatgagcgcc
aagcagacgcacgcggccccggtggcgcccgaggcgcggctggggggcgcgtgctggggc
tgctcgtgcggcgcggagcccgcgccgggccgaggggcgctgccgggggcgcggaccacg
gcgctcctgtaccgctgctgcttctgcggggaagagcacccgcgccagggcagcatcctc
tacaacatgctcacgagcgccaagcagacgcgcgcggctgcggaggcgcccgaggcgcgg
ctggggggcgcgtgctggggctgctcgtgcggcgcggagcccgcggcgggccgaggggcg
ctgccggaggcgcggaccacggtgctcctgtaccgctgctgcttctgcggggaagagcac
ccgcgccagggcagcatcctctacagcttgctcaccagcgccaagcagacgcacgtggcg
ccggaaacgcccgaggtgcggcctgggggcgcgtggtggggccgctcttacagcgcccag
ggcccggggggcagagagcagctgccgggccggcaggccgtggcgtacctgtcccgctgc
tgcttttgcggggacgagcacccgcgccccggcagcatcttccaccgcttgcccgcgagc
gccaagcagacgcacgcggctcgggagatgcagcccgcggccccctggtgggacccccgg
tgtgacgcgcagcgccgagtggccctcaagagtccacaggtggtctgcgaggccgcctcg
gcaggcctgttgaagacgctgcgctttgtcaagtacttaccctgcttccaggtgctccct
ctggaccagcagctggtgctggtgcgcaacagctgggcgccgctgctcctgctcgagctg
gcccaggaccgcttgaactttgagacggtagagacctcggagcccagcctgctgcagagg
atcctcaccaccaggcggcgggagaccgcgggcgacgagccgccgcctccgaccccgcag
ccgccccccttggtaccgccgcgcgaggccgggcgtttgccaacggccgctgaagtccaa
gccatcaagtgcttccttgccaagtgctggagcctggacatcagtaccaaggagtacgcc
tacctcaaggggaccgtgctctttaacccggacctgccaggccttcattgcgtgaagtac
attcagggactccagtggggagctcagcagatactcagtgaccacatcaggatgacccac
agggggtaccaagccagattcaccgaactgaatagtgccctcttcctgctgagatatgtc
aatgctgatgtcatcgtggagctattcttcaggcccatcattggttcggtcagcatggat
gatatgatgctggagatgctctgtgcaaagttatga

DBGET integrated database retrieval system