KEGG   Canis familiaris (dog): 100855619
Entry
100855619         CDS       T01007                                 

Gene name
IGFBP3
Definition
(RefSeq) insulin-like growth factor-binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04115  p53 signaling pathway
cfa04218  Cellular senescence
cfa04935  Growth hormone synthesis, secretion and action
cfa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100855619 (IGFBP3)
   04218 Cellular senescence
    100855619 (IGFBP3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100855619 (IGFBP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100855619 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cfa04131]
    100855619 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cfa04147]
    100855619 (IGFBP3)
Membrane trafficking [BR:cfa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    100855619 (IGFBP3)
Exosome [BR:cfa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100855619 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 100855619
NCBI-ProteinID: XP_003639605
Ensembl: ENSCAFG00000012294
VGNC: 41904
UniProt: F1PQ91
Position
16
AA seq 291 aa
MQGARHALWAAALTALALLKGPPAARAGAGAAGAGPVVRCDPCDARALAQCAPPSAAPAC
PELVREPGCGCCLTCALREGQPCGVYTERCGAGLSCQPPPGEPRPLQAMLDGRGLCANAS
AAGRLRAYLLPAPPAPGNSSESEEDHGAGGAQALPGTHRVPDAKLQPLHTKMDVIKKGHA
KDSQRYKVDYESQSTDTQNFSSEYKRETEYGPCRREVEDTLNRLKFLDMLSPRGIHIPNC
DRKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGFDARGKGDIHCYSMDSK
NT seq 876 nt   +upstreamnt  +downstreamnt
atgcagggggcgcgccacgcgctctgggccgcggcgctgacggcgctggcgctgctaaaa
ggacccccggcggctcgggcgggcgcgggcgcggcgggcgcgggccccgtggtgcgctgc
gatccgtgcgacgcgcgcgccctggctcagtgcgcgccgccgtccgccgcgcccgcgtgc
cccgagctggtgcgggagcccggctgcggatgctgcctgacgtgcgcgctgcgcgagggc
cagccgtgcggcgtatacaccgagcgctgcggcgccggcctcagctgccagccgcctccc
ggggagccgcgcccgctgcaggcgatgctggacggccgcgggctctgcgccaacgccagc
gccgccggccgcttgcgcgcctacctgctgcctgcgccgccagcgccaggaaacagcagc
gagtcggaggaggaccacggcgcggggggcgcgcaggccctgcctggcacgcaccgggtg
cccgacgccaagctgcagcccctgcacacgaagatggatgtcattaagaaggggcacgcc
aaggacagccagcgctacaaggtggactacgagtcccagagcaccgacacccagaacttc
tcctccgagtacaagcgggagacggaatatgggccctgccgccgggaggtggaggacacg
ctgaaccggctcaagttcttggatatgctcagccccaggggcatccacatccccaactgt
gacaggaagggcttctataagaagaagcagtgccgcccctccaagggcaggaagcggggc
ttctgctggtgtgtggacaagtatgggcagccgctgcccggcttcgatgccaggggcaaa
ggcgacattcactgctacagcatggacagcaagtag

DBGET integrated database retrieval system