KEGG   Canis familiaris (dog): 100855641Help
Entry
100855641         CDS       T01007                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 17
  KO
K11845  ubiquitin carboxyl-terminal hydrolase 17 [EC:3.4.19.12]
Organism
cfa  Canis familiaris (dog)
Brite
Enzymes [BR:cfa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100855641
Peptidases [BR:cfa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100855641
Ubiquitin system [BR:cfa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100855641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 HABP4_PAI-RBP1
Motif
Other DBs
NCBI-GeneID: 100855641
NCBI-ProteinID: XP_022272225
Position
Unknown
AA seq 401 aa AA seqDB search
VLCHPGRVLRPLPLLLAAFHRHKQEDAHEYLMFILDAMQQACLPEDKLSDPECPQDSTLI
QQLFGGYWRSQIQCLHCQGISSTLEPYLDISLDIGDAHSVSQALEQLVKPELLEGENAYH
CSKCLEKVPASKVLTLHTSPKVLILVLRRFSDLTGNKMTKEVQYPERLDMQHYLSEQRAG
PLVYVLYAVLVHAGRSCHSGHYFCFVKAGNGQWYKMDDAKVSACDVTCALRQPAYVLFYM
QKTDLERDLGRESVKEGGLASPEADPTVVGEASGEPATDPSVNLPELEERGEETSRQQMT
LDQWRCLQECNRPKPELNVRRREIALPANAVILHHSKYRPEMPKNHPQQTVDLLTTAAGM
LPPQVAGDVAKVPRVPGRARPTKRTSKKGQRSGEAVQGCVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gttctctgccatcctggacgtgtgctccggcccctgccactcctgctcgccgccttccac
agacacaagcaggaagatgcccatgagtatctcatgttcattctggatgcaatgcagcaa
gcgtgcttgcctgaggacaagctctcagaccctgagtgtcctcaggacagcaccctcatc
cagcaactctttggggggtactggaggtctcaaatccagtgtctccactgccaaggcatt
tcgagcactctggaaccttacctggacatcagcctggacatcggggatgctcacagcgtc
agccaagctttggagcagttggtgaagcccgaactgctggaaggtgaaaatgcctaccat
tgtagtaagtgtctggagaaggtgcctgcgtccaaggtgttgactttgcacacttccccg
aaggtcctcatcctggtcttgagacgattctcagacttgacaggcaacaaaatgactaag
gaggtgcaatatcctgagcgccttgacatgcaacactacctgtctgagcagagggcagga
cccttggtttatgtgctctatgccgtgctggtgcacgctgggaggagttgccacagcgga
cattacttctgtttcgtaaaggcaggaaatggccagtggtataaaatggatgatgctaag
gtcagcgcctgtgatgtgacttgcgcgctgcgccaacctgcctatgtcctcttttatatg
cagaagactgatctggagagagaccttgggagggagtcagtcaaagagggaggactcgca
tctcccgaggcagaccccacagtggtgggtgaggcctcaggagagccggcaacggatccc
tccgtgaaccttcctgagttggaggagcgtggggaagagacctcaaggcaacaaatgaca
ttagaccagtggagatgcctccaagaatgcaaccgccctaagcctgaacttaatgtcagg
agaagagaaattgctcttcctgcgaacgcagtcatccttcaccactccaaatacagacct
gagatgccgaagaatcatcctcagcagaccgtcgacctgctcaccactgcggctgggatg
ctcccacctcaggtggccggggacgtggccaaagtcccgcgtgtgccagggagagcccga
cctaccaagaggacgagcaagaagggacagaggtctggggaagcagtccagggatgtgtc
tcctaa

DBGET integrated database retrieval system