KEGG   Canis familiaris (dog): 100855704Help
Entry
100855704         CDS       T01007                                 

Gene name
CDK2
Definition
(RefSeq) cyclin-dependent kinase 2 isoform X3
  KO
K02206  cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04068  FoxO signaling pathway
cfa04110  Cell cycle
cfa04114  Oocyte meiosis
cfa04115  p53 signaling pathway
cfa04151  PI3K-Akt signaling pathway
cfa04218  Cellular senescence
cfa04914  Progesterone-mediated oocyte maturation
cfa04934  Cushing syndrome
cfa05160  Hepatitis C
cfa05161  Hepatitis B
cfa05162  Measles
cfa05165  Human papillomavirus infection
cfa05166  Human T-cell leukemia virus 1 infection
cfa05169  Epstein-Barr virus infection
cfa05200  Pathways in cancer
cfa05203  Viral carcinogenesis
cfa05215  Prostate cancer
cfa05222  Small cell lung cancer
cfa05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100855704 (CDK2)
   04151 PI3K-Akt signaling pathway
    100855704 (CDK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100855704 (CDK2)
   04114 Oocyte meiosis
    100855704 (CDK2)
   04115 p53 signaling pathway
    100855704 (CDK2)
   04218 Cellular senescence
    100855704 (CDK2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100855704 (CDK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100855704 (CDK2)
   05203 Viral carcinogenesis
    100855704 (CDK2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100855704 (CDK2)
   05215 Prostate cancer
    100855704 (CDK2)
   05222 Small cell lung cancer
    100855704 (CDK2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100855704 (CDK2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100855704 (CDK2)
   05162 Measles
    100855704 (CDK2)
   05161 Hepatitis B
    100855704 (CDK2)
   05160 Hepatitis C
    100855704 (CDK2)
   05169 Epstein-Barr virus infection
    100855704 (CDK2)
   05165 Human papillomavirus infection
    100855704 (CDK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cfa01001]
    100855704 (CDK2)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cfa03032]
    100855704 (CDK2)
   03036 Chromosome and associated proteins [BR:cfa03036]
    100855704 (CDK2)
Enzymes [BR:cfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100855704 (CDK2)
Protein kinases [BR:cfa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100855704 (CDK2)
DNA replication proteins [BR:cfa03032]
 Eukaryotic Type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100855704 (CDK2)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100855704 (CDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 100855704
NCBI-ProteinID: XP_003639368
Ensembl: ENSCAFG00000000082
VGNC: 39051
UniProt: E2QW70
Position
10
AA seq 298 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKAKNKVTGEVVALKKIRLDTETEGVPSTAIREISLLKELNH
PNIVKLLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHS
HRVLHRDLKPQNLLINAEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYY
STAVDIWSLGCIFAEMVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccaaaaagtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccaaaaacaaagtgacgggagaagtggtggcgcttaaaaaaatccgcctggacactgag
acggagggtgtacccagtactgctatacgagagatctccctgcttaaggagcttaaccac
ccgaacattgtcaagctattggatgtcatccacacagaaaacaaactctacctggttttt
gaatttctgcaccaggatctgaagaaatttatggatgcttctgctttgactggcattcct
cttcccctcatcaagagctatctgttccagctgctccagggcctagccttctgccattct
catcgggttctgcaccgagacctcaaacctcagaatctgcttatcaacgcagagggggcc
atcaagctagcagactttggattagccagagcctttggagtccctgttcgtacttacacc
catgaggtggtgaccctgtggtaccgagcacctgaaatccttctgggctgcaagtactac
tccacagccgtagatatctggagcttgggctgcatctttgctgagatggtgacccgacgg
gccttattccctggagattctgaaattgaccaacttttccggatctttcggactctgggg
accccagatgaagtggtttggccaggagttacttctatgcctgattataagccgagtttc
cccaagtgggcccggcaagattttagcaaagttgttcctcccttggatgaagatggacgg
agcttgctttcgcaaatgctgcactacgaccccaacaagcggatttcggcaaaggcagct
ctggctcaccctttcttccaggatgtgaccaagccagtaccccaccttcgactctga

DBGET integrated database retrieval system