KEGG   Canis lupus familiaris (dog): 100855759
Entry
100855759         CDS       T01007                                 

Gene name
CHST3
Definition
(RefSeq) carbohydrate sulfotransferase 3
  KO
K01020  chondroitin 6-sulfotransferase 3 [EC:2.8.2.17]
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa00532  Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00532 Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate
    100855759 (CHST3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cfa01003]
    100855759 (CHST3)
Enzymes [BR:cfa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.17  chondroitin 6-sulfotransferase
     100855759 (CHST3)
Glycosyltransferases [BR:cfa01003]
 Unclassified
  Sulfotransferases
   100855759 (CHST3)
SSDB
Motif
Pfam: Sulfotransfer_1 Sulfotransfer_3
Other DBs
NCBI-GeneID: 100855759
NCBI-ProteinID: XP_005619051
Ensembl: ENSCAFG00000014410
VGNC: 39255
UniProt: E2RLE9
Position
4
AA seq 477 aa
MEKGLAFPQDCRDFLHSLRMRSKYALFLAFVVVVFVFIEKENKIISRVSDKLKQIPQPLV
DANSTDPALILADNASLLSLSELDSAFTQLQGRLRNLSLQLGVEPAGEAEAGLEAAAREG
GPPRPTEARPRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFEPLWHIERTVTFEPGGANA
AGAALVYRDVLKQLFLCDLYVLEHFISPLPEDHLTQFMFRRGSSRSLCEEPVCTPFVKKV
FEKYHCKNRRCGPLNVTLAAEACRRKDHMALKAVRIRQLEFLQPLAEDPRLDLRVIQLVR
DPRAVLASRMVAFAGKYEGWKKWLAEGQARLGEEEVQRLRGNCESIRLSAELGLRQPAWL
RGRYMLVRYEDVARWPLQKAREMYRFAGIPLTAQVEDWIRRNTQAAQDASGIYSTQKNSS
EQFEKWRFGMPFKLAQVVQAACGPAMRLFGYRLARDAAALANRSVSLLEERGTFWVT
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggagaaaggactcgcttttccccaggactgccgggactttctgcacagcctgagaatg
aggagcaaatatgcccttttcctggcttttgtggtggtggtttttgtcttcattgaaaag
gaaaataaaatcatatcaagggtgtcagacaagctgaagcagatcccacaacccctggtg
gacgccaacagcaccgacccggccctgatcttggcggacaacgcgtccctcctgtccctg
agcgagctggattcagccttcacccagctgcagggccgcctgcggaacctgagtctgcag
ctgggcgtagagcccgccggggaggccgaggccgggctggaggccgcggcccgggaaggg
gggccaccccggcccaccgaggcccggccgcggcgccacgtgctcctcatggccaccacg
cgcaccggctcctcgttcgtgggcgagttcttcaaccagcagggcaacatcttctacctc
ttcgagccgctgtggcacatcgagcgcaccgtgaccttcgagcccggaggcgccaacgcg
gcgggcgcggccctggtctaccgcgacgtgctcaagcagctgttcctgtgcgacctgtac
gtgctggagcacttcatcagcccgctgcccgaggaccacctgacccagttcatgttccgc
cgcggctccagccgctcgctgtgcgaggagcccgtgtgcacgcccttcgtcaagaaggtc
ttcgagaagtaccactgcaagaaccgccgctgcgggccgctcaacgtgacgctggccgcc
gaggcctgccgccgcaaggaccacatggcgctcaaggccgtgcgcatccggcagctggag
ttcctgcagccgctggccgaggacccgcggctggacctgcgcgtcatccagctggtgcgg
gacccgcgcgccgtgctggcctcccgcatggtggccttcgccggcaagtacgagggctgg
aagaagtggctggccgagggccaggcgcgcctgggcgaggaggaggtgcagcggctgcgg
ggcaactgcgagagcatccggctgtcggccgagctgggcctgcggcagcccgcctggctg
cgcggccgctacatgctggtgcgctacgaggacgtggcgcgctggccgctgcagaaggcg
cgcgagatgtaccgcttcgccggcatcccgctcacggcgcaggtggaggactggatccgc
aggaacacgcaggcggcccaggacgccagcggcatctactccacgcagaagaactcctcg
gagcagttcgagaagtggcgcttcggcatgcccttcaagctggcgcaggtggtgcaggcc
gcctgcgggcccgccatgcgcctcttcggctaccggctggcgcgggacgccgccgccctg
gccaaccgctccgtcagcctgctggaggagcggggaaccttctgggtcacgtag

DBGET integrated database retrieval system