KEGG   Canis familiaris (dog): 100855774Help
Entry
100855774         CDS       T01007                                 

Gene name
CDC20
Definition
(RefSeq) cell division cycle protein 20 homolog
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
cfa  Canis familiaris (dog)
Pathway
cfa04110  Cell cycle
cfa04114  Oocyte meiosis
cfa04120  Ubiquitin mediated proteolysis
cfa05166  Human T-cell leukemia virus 1 infection
cfa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100855774 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100855774 (CDC20)
   04114 Oocyte meiosis
    100855774 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100855774 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100855774 (CDC20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cfa04121]
    100855774 (CDC20)
   03036 Chromosome and associated proteins [BR:cfa03036]
    100855774 (CDC20)
Ubiquitin system [BR:cfa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     100855774 (CDC20)
Chromosome and associated proteins [BR:cfa03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    100855774 (CDC20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb
Motif
Other DBs
NCBI-GeneID: 100855774
NCBI-ProteinID: XP_003639578
Ensembl: ENSCAFG00000005259
VGNC: 38987
UniProt: E2RGS2
Position
15
AA seq 499 aa AA seqDB search
MAQFVFESDLHSLLQLDAPIPNAPPARWQRKAREAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKAQTTPSKPGGDRYIPHRSASQMEVASFLLSKENQPEESHTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSTRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNY
LAVGTSSAEVQLWDVQQQKRLRNMTGHSARVSSLCWNSYILSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAQSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagttcgtgttcgagagcgacctgcactcgctgctgcagctggacgcgcccatc
cccaatgcgccccccgcgcgctggcagcgcaaggccagggaggccgcaggcccggcgcct
tcgcccatgcgggcggccaaccggtcccacagcgccggcaggacccccggccggactccg
ggcaagtccagctccaaggctcagaccactcccagcaaacccggcggggaccgctacatc
ccccatcgcagtgcttcccagatggaggtggccagtttcctcctgagcaaggaaaaccag
cctgaagagagccacacgcccaccaagaaggaacatcagaaagcctgggctctgaacctg
aacggttttgacgtggaggaagccaagatcctgcggctcagtggaaaaccacagaatgcc
ccagagggttaccagaacagactgaaagtgctgtacagccagaaggccacgcctggctcc
acccggaagacctgccgttacattccctccctgccagaccgaatcctggacgcccctgaa
atccggaatgactactacctgaaccttgtggactggagctctgggaatgtgctggctgtg
gcgttggacaacagtgtgtacttgtggagtgctagctccggtgacatcttgcagctgctg
cagatggagcagcctggggagtacatatcttctgtggcctggatcaaggagggcaactac
ctggctgtgggcaccagcagtgctgaggtgcagctgtgggacgtgcagcagcagaagcgg
cttcgaaacatgaccggtcattctgcccgagtgagctccctgtgctggaacagctatatc
ttgtccagtggctcacgttctggccacatccatcaccatgatgttcgggtcgcagaacac
catgtggccacactgagtggccacagccaggaggtgtgtggactgcgctgggccccagat
ggacgacatttggccagcggtggcaacgacaacttggtcaatgtgtggcctagtgctcct
ggagagggtggctgggtgcccctgcagacattcacccagcaccaaggggcagtcaaggct
gtagcttggtgtccgtggcagtccaatgtcctggcaactggagggggcaccagtgaccga
cacattcgcatctggaatgtctgctctggggcctgcctgagtgccgtggatgctcaatcc
caggtgtgctccatcctctggtctccccactacaaggagctcatctctggccatggcttt
gcccagaaccagttggttatttggaaatacccaaccatggccaaggtggctgagcttaaa
ggtcacactgcccgggtactcagcctgaccatgagcccggacggggccactgtggcctca
gcagccgcagatgagaccctgcggctatggcgctgctttgagttggatcctgcgcggcgg
cgggaacgggagaaggccagcgcggccaagagcagcctcatccaccaaggcatccgttga

DBGET integrated database retrieval system