KEGG   Canis lupus familiaris (dog): 100855878
Entry
100855878         CDS       T01007                                 

Gene name
TNFSF4
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 4
  KO
K05469  tumor necrosis factor ligand superfamily member 4
Organism
cfa  Canis lupus familiaris (dog)
Pathway
cfa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cfa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100855878 (TNFSF4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cfa04052]
    100855878 (TNFSF4)
   04090 CD molecules [BR:cfa04090]
    100855878 (TNFSF4)
Cytokines and growth factors [BR:cfa04052]
 Cytokines
  Tumor necrosis fators
   100855878 (TNFSF4)
CD molecules [BR:cfa04090]
 Proteins
  100855878 (TNFSF4)
SSDB
Other DBs
NCBI-GeneID: 100855878
NCBI-ProteinID: XP_003639215
Ensembl: ENSCAFG00000014587
VGNC: 47672
UniProt: E2RP79
Position
7
AA seq 183 aa
MEGVQPLDQNVGNTPGRRFQKNKVLLVAAIIQGLGLLLCFTYICLHFYASQVPPQYPPIQ
SIRVQFTRCENEKGCIITSPSKDETMKVQDNSIIINCDGFYLISLKGYFSEELSLSLYYR
KGRGPLFSLSKVTSVDSIGVAYLAFKDKVYFNVTTHSTSYKDIQVNGGELILIHQNPGGF
CAY
NT seq 552 nt   +upstreamnt  +downstreamnt
atggaaggggtccaacccctggaccagaatgtgggaaacacaccagggcgaagattccag
aagaacaaggtattgctggtggcagccataattcaggggctgggtctgctcctgtgtttc
acctacatctgcctgcacttctatgcttctcaggtgccgcctcagtatcctccaattcaa
agtatcagagtacaatttaccaggtgtgagaatgagaaaggttgcatcatcacatcccca
agcaaggatgaaactatgaaggtgcaagacaactcaatcatcattaactgtgatgggttt
tatctcatctccctgaagggttacttctctgaggagctcagcctcagcctttattaccga
aagggtcggggacccctcttctctctgagcaaggtcacatctgttgactccattggagtg
gcctatctggctttcaaggacaaagtctactttaatgtgaccactcacagtacctcctac
aaagacatccaggtgaatggtggggaattgattctcattcatcaaaatcctggtggcttc
tgtgcctactga

DBGET integrated database retrieval system